KEGG   Mycobacterium canettii CIPT 140060008: BN44_10265Help
Entry
BN44_10265        CDS       T02419                                 

Gene name
php
Definition
(GenBank) Putative phosphotriesterase Php (parathion hydrolase) (PTE) (aryldialkylphosphatase) (paraoxonase) (a-esterase) (aryltriphosphatase) (paraoxon hydrolase)
  KO
K07048  phosphotriesterase-related protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BN44_10265 (php)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTE Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: CCK50150
Position
complement(280639..281619)
Genome map
AA seq 326 aa AA seqDB search
MPELNTARGPIDTADLGVTLMHEHVFIMTTEIAQNYPEAWGDEDKRVAGAIARLGELKVR
GVDTIVDLTVIGLGRYIPRIARVAAATELNIVVATGLYTYNDVPFYFHYLGPGAQLDGPE
IMTDMFVRDIEHGIADTGIKAGILKCATDEPGLTPGVERVLRAVAQAHKRTGVPISTHTH
AGLRRGLDQQRIFAEEGVDLSRVVIGHCGDSTDVGYLEELIAAGSYLGMDRFGVDVISPF
QDRVNIVARMCERGHADKMVLSHDACCYFDALPEELVPVAMPNWHYLHIHNDVIPALKQH
GVTDEQLHTMLVDNPRRIFERQGGYQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaactaaataccgctcgcggacccatcgacaccgctgatctcggcgtcacgctc
atgcacgagcacgtcttcatcatgaccaccgagattgcgcagaactacccggaagcctgg
ggcgacgaggacaagcgggtggccggcgccatcgcccggctaggcgaactcaaggtccgc
ggcgtggacaccatcgtcgacctcacggtgatcgggctgggccgatacatcccgcgcatc
gcccgggtggccgcggccaccgagctgaacatcgtcgtggccaccggcttgtacacctac
aacgacgtcccgttctacttccactacctcgggccgggcgcacagctggacggcccggag
atcatgaccgacatgttcgtccgcgacatcgagcacggcatcgccgacaccggcatcaag
gcgggaatcctcaagtgcgccaccgacgaacccggcctcacccctggtgtcgagcgggtg
ttgcgcgcggtcgcccaagcacacaaacgcaccggggtgccgatctccacccacacccac
gccgggctgcggcgcggccttgaccagcaacgcatcttcgccgaggagggggtggacctg
agccgggtggttatcggacactgcggcgacagcaccgacgtcggctacctggaagagctc
atcgccgccggctcctacctcgggatggaccggttcggcgtcgacgtgatctcaccgttt
caggaccgggtgaacatcgtggcccgaatgtgcgagcgcggccatgccgacaagatggtg
ctatcacacgacgcctgctgctatttcgacgcgcttcccgaggagctggtgccggtggcg
atgccgaattggcattacctccacatccacaacgacgtcatccccgcactgaagcagcac
ggcgtcaccgacgagcagctgcacaccatgctcgtcgacaacccgcgccgcatcttcgag
cggcagggcggctatcagtga

DBGET integrated database retrieval system