KEGG   Mycobacterium canettii CIPT 140060008: BN44_10268Help
Entry
BN44_10268        CDS       T02419                                 

Gene name
nrdB
Definition
(GenBank) Putative ribonucleoside-diphosphate reductase (beta chain) NrdB (ribonucleotide reductase small chain)
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00230  Purine metabolism
mcq00240  Pyrimidine metabolism
mcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BN44_10268 (nrdB)
   00240 Pyrimidine metabolism
    BN44_10268 (nrdB)
Enzymes [BR:mcq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BN44_10268 (nrdB)
DNA repair and recombination proteins [BR:mcq03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BN44_10268 (nrdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm Haem_oxygenas_2
Motif
Other DBs
NCBI-ProteinID: CCK50153
Position
284241..285185
Genome map
AA seq 314 aa AA seqDB search
MTRTRSGSLAAGGLNWASLPLKLFAGGNAKFWDPADIDFTRDRADWEKLSDDERDYATRL
CTQFIAGEEAVTEDIQPFMSAMRAEGRLADEMYLTQFAFEEAKHTQVFRMWLDAVGISED
LHRYLDDLPAYRQIFYAELPECLNALSADPSPAAQVRASVTYNHIVEGMLALTGYYAWHK
ICVERAILPGMQELVRRIGDDERRHMAWGTFTCRRHVAADDANWTVFETRMNELIPLALR
LIEEGFALYGDQPPFDLSKDDFLQYSTDKGMRRFGTISNARGRPVAEIDVDYSPAQLEDT
FADEDRRTLASASA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcacacgttcgggctcgctcgccgcgggcggactcaactgggcgagcctgcca
ctgaagctgttcgccgggggcaacgcaaagttctgggatccggccgacatcgacttcacg
cgcgaccgggcggactgggagaagttgtcggatgacgaacgtgactacgccacccgattg
tgcacccagttcattgccggcgaggaggcggtgaccgaggacatccagccgttcatgtcc
gcgatgcgggccgagggacggctggccgatgagatgtatctgacgcagttcgcgttcgag
gaagccaaacacacccaggtgtttcgcatgtggctggatgccgtcggaatcagcgaagac
ttgcatcgctatctcgacgacttgcccgcctaccgccaaatcttctacgcggagttgccg
gagtgcctcaacgcattgtcggccgatccctcaccggccgcccaggtccgggcgtcggtc
acctacaaccacatcgtggaaggcatgctggcgctcacgggctactacgcctggcacaag
atctgtgtggaacgcgcaatccttcccggcatgcaggagctggtccggcgcatcggtgac
gacgagcgacgccacatggcttggggcaccttcacctgtcggcgccacgtcgccgccgac
gacgccaattggacggtgttcgaaacacggatgaacgagctcatcccgctggcgctgcgc
ctcatcgaggagggctttgcgctgtacggcgaccagcccccattcgacctgtccaaggac
gatttcctgcaatactcgaccgacaagggaatgcgccggttcggcaccatcagcaacgcc
cgcggccggccggtcgccgaaatcgacgtcgactactcgcccgcgcagctggaggacacc
ttcgccgacgaggaccggcgcaccctggcctcggcctcggcctag

DBGET integrated database retrieval system