KEGG   Mycobacterium canettii CIPT 140060008: BN44_10277Help
Entry
BN44_10277        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function, win PIN domain
  KO
K07064  uncharacterized protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN
Motif
Other DBs
NCBI-ProteinID: CCK50160
Position
295001..295438
Genome map
AA seq 145 aa AA seqDB search
MLSIDTNILLYAQNRDCPEHDAAAAFLVECAGRADVAVCELVLMELYQLLRNPTVVTRPL
EGPEAAEVCQTFRRNRRWALLENAPVMNEVWVLAATPRIARRRLFDARLALTLRHHGVDE
FATRNINGFTDFGFSRVWDPITSDG
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgctctcgatcgatacgaatatcctgctgtacgcgcagaaccgggattgccccgagcat
gacgccgccgccgccttcctcgtcgagtgcgctggtcgagccgacgtcgcagtctgcgaa
ctcgtgcttatggagctgtatcaattgctgcggaatcctacggtggtgacgcgaccgctc
gagggccccgaggcggcggaagtctgtcagacgttccgtcgcaaccggcggtgggcgctc
ctcgagaacgctccggtcatgaacgaggtgtgggtgttggcggccacgcctagaattgct
cgccggcgcctattcgatgcccggctggcactgaccttgcgccatcatggtgtcgacgaa
ttcgccactcgaaacatcaacggcttcaccgacttcggcttctcacgcgtgtgggacccg
ataacgtcggatggctga

DBGET integrated database retrieval system