KEGG   Mycobacterium canettii CIPT 140060008: BN44_10281Help
Entry
BN44_10281        CDS       T02419                                 

Gene name
fadE
Definition
(GenBank) Putative acyl-CoA dehydrogenase FadE5
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_M Acyl-CoA_dh_1 AcylCoA_DH_N Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: CCK50164
Position
complement(299455..301290)
Genome map
AA seq 611 aa AA seqDB search
MSHYRSNVRDQVFNLFEVLGVDKALGHGEFSDVDVDTARDMLAEVSRLAEGPVAESFVEG
DRNPPVFDPKTHSVMLPESFKKSVNAMLEAGWDKVGIDEALGGMPMPKAVVWALHEHILG
ANPAVWMYAGGAGFAQILYHLGTEEQKKWAVLAAERGWGSTMVLTEPDAGSDVGAARTKA
VQQADGSWHIDGVKRFITSGDSGDLFENIFHLVLARPEGAGPGTKGLSLYFVPKFLFDVE
TGEPGERNGVFVTNVEHKMGLKVSATCELAFGQHGVPAKGWLVGEVHNGIAQMFEVIEQA
RMMVGTKAIATLSTGYLNALQYAKSRVQGADLTQMTDKTAPRVTITHHPDVRRSLMTQKA
YAEGLRALYLYTATFQDAAVAEVVHGVDAKLAVKVNDLMLPVVKGVGSEQAYAKLTESLQ
TLGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFFFRKIVRDKGVALAHVSGQIQEF
VDSGAGNGRLKTERALLAKALTDVQGMAAALTGYLMAAQQDVTSLYKVGLGSVRFLMSVG
DLIIGWLLQRQAAVGVAALDAGATGDERSFYEGKVAVASFFAKNFLPLLTSTREVIETLD
NDIMELDEAAF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgagccactaccggagcaacgtccgtgaccaggtttttaacctgttcgaagtgctgggc
gtcgacaaagctttgggccatggcgaattcagcgacgtcgacgtcgacaccgcccgcgac
atgctggcagaggtcagccggctggccgaggggccggtggccgagtcgttcgtcgaaggg
gaccgcaacccgccagttttcgacccgaaaacccactcggtgatgctgccggaatcgttc
aaaaagtcagtcaacgcgatgctggaagccggttgggacaaggtcggcatcgacgaggca
ctcgggggcatgccgatgcccaaggcagtggtctgggcgctgcatgagcacatcttgggc
gccaatccggcggtatggatgtacgccggcggcgcgggcttcgcccagatcctctaccac
ctcggcaccgaggagcagaagaagtgggcggtcctagccgccgaacgcggctggggatcg
accatggtgctcaccgagccggatgccggctccgatgtgggcgctgcccgaaccaaagct
gtccaacaggccgacgggtcctggcacatcgacggcgtcaagcggttcattacctcgggt
gactccggcgacctgttcgagaacatcttccacctggtgctggctcgcccggagggcgcc
ggtcccggcaccaagggcctgtcgctgtatttcgtgcccaagttcctgttcgacgtcgaa
accggcgaacccggcgagcgcaatggcgtgttcgtcaccaacgtcgaacacaagatgggc
ctaaaggtctcggcgacctgtgaactggcgttcggccaacacggcgtccccgccaagggc
tggctggtcggcgaggtacacaacggcatcgcgcagatgttcgaggtcattgagcaggcc
cgcatgatggtcggcacgaaggccatcgcgacgctgtccaccggctacctcaacgcgctt
cagtacgccaagtcccgcgtgcagggtgccgacctgacccagatgaccgacaagaccgcg
ccccgggtgacgatcacacatcaccccgacgtgcgccgctcgctgatgacccagaaggct
tacgccgagggcctgcgtgcgctctacctctacaccgccactttccaggacgcggctgtc
gccgaggtggtgcacggtgtggacgccaagttggccgtcaaggtcaacgacctgatgttg
ccggtagtcaagggtgtgggctccgaacaggcttacgccaagctcactgaaagcctgcaa
accctgggtggatccggcttcttgcaggactatccgatcgagcagtacatccgggacgcc
aagatcgactccctgtacgaaggcaccaccgccatccaggcacaagacttcttcttccgc
aaaatcgtccgtgacaagggcgtggcgttggcgcacgtgtcaggccagatccaggagttc
gtcgacagcggtgctggcaacggccggctgaagaccgaacgcgcgctgctggccaaggcg
ctcaccgacgtccagggcatggcggccgcactgaccggctacctgatggccgcgcagcag
gacgtcaccagcctctacaaggtgggcttgggttcggtgcgcttcttgatgagcgtcggt
gacctcatcatcggctggttgctgcagcgtcaggccgcggtgggggtggcggcactcgac
gcgggtgccaccggcgacgagcggtccttctacgaaggcaaagtcgcggtggcgtcgttc
ttcgcgaagaacttcttgccgctgttgaccagcacccgcgaggtgatcgagacgctggac
aacgacatcatggaactcgacgaggccgcgttctga

DBGET integrated database retrieval system