KEGG   Mycobacterium canettii CIPT 140060008: BN44_110011Help
Entry
BN44_110011       CDS       T02419                                 

Gene name
ltp
Definition
(GenBank) Putative lipid carrier protein or Keto acyl-CoA thiolase Ltp3
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00071  Fatty acid degradation
mcq00072  Synthesis and degradation of ketone bodies
mcq00280  Valine, leucine and isoleucine degradation
mcq00310  Lysine degradation
mcq00362  Benzoate degradation
mcq00380  Tryptophan metabolism
mcq00620  Pyruvate metabolism
mcq00630  Glyoxylate and dicarboxylate metabolism
mcq00640  Propanoate metabolism
mcq00650  Butanoate metabolism
mcq00900  Terpenoid backbone biosynthesis
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01120  Microbial metabolism in diverse environments
mcq01130  Biosynthesis of antibiotics
mcq01200  Carbon metabolism
mcq01212  Fatty acid metabolism
mcq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN44_110011 (ltp)
   00630 Glyoxylate and dicarboxylate metabolism
    BN44_110011 (ltp)
   00640 Propanoate metabolism
    BN44_110011 (ltp)
   00650 Butanoate metabolism
    BN44_110011 (ltp)
  Lipid metabolism
   00071 Fatty acid degradation
    BN44_110011 (ltp)
   00072 Synthesis and degradation of ketone bodies
    BN44_110011 (ltp)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN44_110011 (ltp)
   00310 Lysine degradation
    BN44_110011 (ltp)
   00380 Tryptophan metabolism
    BN44_110011 (ltp)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN44_110011 (ltp)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN44_110011 (ltp)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN44_110011 (ltp)
Enzymes [BR:mcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN44_110011 (ltp)
Exosome [BR:mcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN44_110011 (ltp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Thiolase_N
Motif
Other DBs
NCBI-ProteinID: CCK53528
Position
3980508..3981692
Genome map
AA seq 394 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSLPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQAHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctattcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgcttcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgac
gaggagatcgccgacgcgcggctggcgcaagcgcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system