KEGG   Mycobacterium canettii CIPT 140060008: BN44_110048Help
Entry
BN44_110048       CDS       T02419                                 

Gene name
fadA
Definition
(GenBank) Putative Acetyl-CoA Acetyltransferase FadA6 (Acetoacetyl-CoA Thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00071  Fatty acid degradation
mcq00072  Synthesis and degradation of ketone bodies
mcq00280  Valine, leucine and isoleucine degradation
mcq00310  Lysine degradation
mcq00362  Benzoate degradation
mcq00380  Tryptophan metabolism
mcq00620  Pyruvate metabolism
mcq00630  Glyoxylate and dicarboxylate metabolism
mcq00640  Propanoate metabolism
mcq00650  Butanoate metabolism
mcq00900  Terpenoid backbone biosynthesis
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01120  Microbial metabolism in diverse environments
mcq01130  Biosynthesis of antibiotics
mcq01200  Carbon metabolism
mcq01212  Fatty acid metabolism
mcq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN44_110048 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN44_110048 (fadA)
   00640 Propanoate metabolism
    BN44_110048 (fadA)
   00650 Butanoate metabolism
    BN44_110048 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN44_110048 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BN44_110048 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN44_110048 (fadA)
   00310 Lysine degradation
    BN44_110048 (fadA)
   00380 Tryptophan metabolism
    BN44_110048 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN44_110048 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN44_110048 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN44_110048 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcq04147]
    BN44_110048 (fadA)
Enzymes [BR:mcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN44_110048 (fadA)
Exosome [BR:mcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN44_110048 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCK53561
Position
complement(4016783..4017943)
Genome map
AA seq 386 aa AA seqDB search
MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS
QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL
TSHERAFAAIRTGHFENEIITVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMA
SQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELE
RIGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcgtacgtcatcgacgccgtacggaccgcggtcggcaagcggggcggcgca
ctggccggtatccatcccgtcgacctgggtgccctggcctggcgcggactgctggaccgg
accgacatcgaccccgccgccgtcgacgacgtgatcgccggatgtgtcgacgccatcggc
ggacaggcgggcaacatcgcccgactgtcgtggctggccgccggctatcccgaagaggtc
cccggtgtcaccgtggaccgccagtgcggatccagccagcaggcgatttcctttggcgcg
caggcgatcatgtccggcacggcggatgtcatcgtggccggcggcgtgcagaacatgagc
cagatcccgatctcgtcggcgatgaccgtgggcgaacagttcgggttcacctcgccgacc
aacgaatccaagcaatggttacaccggtatggcgaccaggagatttcacagttccgtggc
tcggagctgatcgccgagaagtggaacctgtcccgtgaagagatggagcggtactcgctg
accagccacgaacgcgcgttcgcggcgatccgcaccggccacttcgaaaacgaaatcatc
actgtggaaaccgaatccgggccgttccgggttgatgagggcccgcgggagtcgtcgctg
gagaagatggccggcttgcagccgctggtcgagggcggccggctgacggcggcgatggcc
agtcagatctccgacggcgccagtgcagtgttgctggcctccgagcgggccgtcaaagac
catggacttaggccccgtgcccgcatccaccacatcagtgcgcgcgccgccgacccggta
ttcatgctgaccggacccatccccgccacccggtacgcgctggacaagaccgggcttgcc
atcgacgacatcgacaccgtcgagatcaacgaggcgttcgcgccggtagttatggcctgg
ctcaaggaaatcaaggccgacccggcgaaggtcaaccccaacggcggcgcgatcgcgctg
gggcatccgctaggcgccaccggcgccaaactgttcaccaccatgctgggcgagctggag
cgcatcggtggccgctacgggctgcagaccatgtgcgagggcggcggcaccgccaacgtc
accattatcgagcggctgtag

DBGET integrated database retrieval system