KEGG   Mycobacterium canettii CIPT 140060008: BN44_110058Help
Entry
BN44_110058       CDS       T02419                                 

Gene name
nat
Definition
(GenBank) Arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00983  Drug metabolism - other enzymes
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BN44_110058 (nat)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BN44_110058 (nat)
   00983 Drug metabolism - other enzymes
    BN44_110058 (nat)
Enzymes [BR:mcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     BN44_110058 (nat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: CCK53571
Position
complement(4028310..4029161)
Genome map
AA seq 283 aa AA seqDB search
MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADK
LVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGS
GGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFT
TQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLA
DAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcactggatctgaccgcgtacttcgatcgcatcaactatcgcggcgctaccgatcca
accctggatgttctgcaggatctggtgaccgtgcacagtcgaacgattccgttcgagaac
ctcgacccgctgctgggggtgccggtcgacgacctcagtccacaggcgctggccgacaag
ctggtacttcggcgccgaggcgggtactgctttgagcacaacgggctgatgggttatgtg
ctggccgaactcggctatcgggtgcgccgattcgccgcccgcgtcgtctggaagctcgcg
ccggacgcgcccctgccgccgcagacgcacaccctgctgggggtcacgttccccggctcg
ggcggatgctatctcgtcgacgtcggattcggcggccaaacaccgacctcaccgcttcgc
ctcgaaaccggcgccgtccagccgacaacgcacgaaccttatcggctcgaggaccgcgtc
gacggctttgtcttgcaggcgatggtccgggacacatggcagacactgtacgaattcacc
acccagacccgcccgcagatcgatctgaaagtggccagctggtacgcctcaacacacccg
gcatcgaagttcgtcacgggactgaccgccgcggtgatcaccgacgacgcccggtggaac
ctatctggccgcgaccttgccgttcaccgtgccggtggtaccgagaagatccgccttgcc
gatgcggcagcggttgtcgacaccctgagcgaacggttcgggatcaacgtggcagatatc
ggcgagcgcggcgcgctcgagacgcgcatcgacgagctattggctcggcagccaggagcc
gatgcgccgtaa

DBGET integrated database retrieval system