KEGG   Mycobacterium canettii CIPT 140060008: BN44_60495Help
Entry
BN44_60495        CDS       T02419                                 

Definition
(GenBank) Putative oxidoreductase
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct
Motif
Other DBs
NCBI-ProteinID: CCK52986
Position
complement(3389558..3390172)
Genome map
AA seq 204 aa AA seqDB search
MSEDVARIHDGDVIDESFDELMGMLDHPVFVVTTQADGHPAGCLVSFATQTSMQPPSFMV
GLPRSTGTSEVASRSEHLAVHVLSRRQHVLAELFGSQTEEEVNKFARCSWRAGPCGMPIL
DDAAAWFIGRTASRSDVGDYVAYLLEPVSVWAPECSEDLLYLSDLDFDVDDIDPGKEASP
RFYERERGDETRRYGVVRFTLDVP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaagacgttgcgcggattcatgatggtgatgtgatcgatgagtcgttcgacgag
ttgatggggatgctggaccacccggtgtttgtggtgacaacccaggccgatggtcacccc
gcgggttgtctggtcagcttcgctacccaaacgagcatgcagcccccgagttttatggtc
ggcctgccgaggagcaccggcacctccgaggtggcgagccgatccgagcacctcgccgtg
cacgtgctttcgcggcggcagcatgtgctcgccgaactgttcggcagccaaacggaggag
gaggtcaacaagttcgcccgttgctcgtggcgcgctggcccctgtggaatgccgattctc
gacgacgcggccgcctggttcatcggtaggacggccagtcgcagcgatgtcggggattat
gtggcttacctgttggagcccgtgagcgtgtgggctccggagtgctcggaagatctgctc
tacctctccgacctcgactttgatgtcgacgacatcgaccctggcaaggaagcctcaccc
cggttctacgagcgtgaacggggcgacgagacacgccgatacggcgtcgtaaggttcacg
ctcgacgtgccctaa

DBGET integrated database retrieval system