KEGG   Mycobacterium canettii CIPT 140060008: BN44_60496Help
Entry
BN44_60496        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCK52987
Position
3390366..3390989
Genome map
AA seq 207 aa AA seqDB search
MLTVVAVIGILECGLLLHMPDNDLWYCGPWTLWVMAGRGVASGAGVWRGDRVATPLAVAI
TAAGLVSGARIGPGAAAKRDPQLAQWNEIRSHYQEIAEWIDHDTATAHPAVAATQISAAG
SFGRANMVDYLGLLDSRADETVRRGEFSRWLSAKPDYLVTTEQSVDAATIALPEFRHAYD
RAATIGTLNVYRRNSPDGDEPLPADGN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctcactgtcgtcgctgtcataggcatactcgaatgtggattactgctacacatgcct
gacaacgatttgtggtactgcgggccatggacactatgggtgatggccggtaggggtgtt
gcgtcgggcgcgggagtgtggcgaggtgatcgcgttgcgacgccccttgcggtggcgatt
accgcagccggattggtatcaggggcccggataggacccggtgcggctgcgaaacgcgac
ccgcagctcgcacagtggaacgagattcgcagtcactaccaagagatcgccgagtggatc
gaccacgacacagcaaccgcacaccccgctgttgccgcaacgcagatcagtgccgctggc
tctttcggccgcgccaatatggtcgactacctggggctcctggattccagggccgacgaa
acggtccgacgcggcgaattttcgcggtggctgtcggccaaacccgactacttggtcacc
accgagcaatctgtcgacgccgccacgatagcccttcctgaattccgccatgcgtacgac
cgcgcggccaccatcgggacactcaacgtgtatcgtcgcaactcccctgacggtgatgaa
ccgctacccgcggacggcaactaa

DBGET integrated database retrieval system