KEGG   Mycobacterium canettii CIPT 140060008: BN44_60502Help
Entry
BN44_60502        CDS       T02419                                 

Gene name
ligA
Definition
(GenBank) Putative DNA ligase [NAD dependent] LigA (polydeoxyribonucleotide synthase [NAD+])
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq03030  DNA replication
mcq03410  Base excision repair
mcq03420  Nucleotide excision repair
mcq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BN44_60502 (ligA)
   03410 Base excision repair
    BN44_60502 (ligA)
   03420 Nucleotide excision repair
    BN44_60502 (ligA)
   03430 Mismatch repair
    BN44_60502 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcq03032]
    BN44_60502 (ligA)
   03400 DNA repair and recombination proteins [BR:mcq03400]
    BN44_60502 (ligA)
Enzymes [BR:mcq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     BN44_60502 (ligA)
DNA replication proteins [BR:mcq03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     BN44_60502 (ligA)
DNA repair and recombination proteins [BR:mcq03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     BN44_60502 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BN44_60502 (ligA)
   MMR (mismatch exicision repair)
    DNA ligase
     BN44_60502 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BN44_60502 (ligA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 PTCB-BRCT DNA_ligase_ZBD HHH Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: CCK52993
Position
complement(3396267..3398342)
Genome map
AA seq 691 aa AA seqDB search
MSSPDADQTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPE
LRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLC
ELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLE
VRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGH
VEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVK
VDEVALQRRLGSTSRAPRWAIAYKYPPEEAQTKLLDIRVNVGRTGRITPFAFMTPVKVAG
STVGQATLHNASEIKRKGVLIGDTVVIRKAGDVIPEVLGPVVELRDGSEREFIMPTTCPE
CGSPLAPEKEGDADIRCPNARGCPGQLRERVFHVASRNGLDIEVLGYEAGVALLQAKVIA
DEGDLFALTEQDLLRTDLFRTKAGELSANGKRLLANLDKAKAAPLWRVLVALSIRHVGPT
AARALATEFGSLDAIAAASTDQLAAVEGVGPTIAAAVTEWFDVDWHREIVDKWRAAGVRM
VDERDESVPRTLAGLTIVVTGSLTGFSRDDAKEAIVARGGKAAGSVSKKTNYVVAGDSPG
SKYDKAVELGVPILDEDGFRRLLADGPASRT
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccccagacgccgatcagaccgctcccgaggtgttgcggcagtggcaggcactg
gccgaggaggtgcgtgagcaccagttccgttattacgtgcgggacgcgccgatcatcagc
gacgcggaattcgacgagctgctgcgccgtctggaagccctcgaggagcagcatcccgag
ctgcgcacgcccgattcgccgacccagctggtcggcggtgccggcttcgccacggatttc
gagcccgtcgaccatctcgaacgaatgctcagcctcgacaacgcgttcaccgccgacgaa
ctcgccgcctgggccggccgcatccatgccgaggtcggagacgccgcacattacctgtgt
gagctcaagatcgacggcgtcgcgctgtctttggtctaccgcgagggacggctgacccgg
gcctccacccgcggcgacgggcgcaccggcgaggacgtcaccctgaacgcccggaccatc
gccgacgttcccgaacggctcacccccggcgacgactacccggtgcccgaggtcctcgag
gtccgcggcgaggtcttcttccggctggacgacttccaggcgctcaacgccagcctcgtc
gaggagggcaaggcgccgttcgccaacccccgcaacagcgcggcgggatcgctgcgccag
aaagacccggcggtcaccgcgcgccgccggctgcggatgatctgccacgggctgggccac
gtggagggctttcgcccggccaccctgcatcaggcatacctggcgttgcgggcatgggga
ctgccggtttccgaacacaccaccctggcaaccgacctggccggtgtgcgcgagcgcatc
gactactggggcgagcaccgccacgaggtggaccacgaaatcgacggcgtggtggtcaaa
gtcgacgaggtggcgttgcagcgcaggctgggttccacgtcgcgggcgccgcgctgggcc
atcgcctacaagtacccgcccgaggaagcgcagaccaagctgctcgacatccgggtgaac
gtcggccgcaccgggcggatcacgccgtttgcgttcatgacgccggtgaaggtggccggg
tcgacggtgggacaggccaccctgcacaacgcctcggagatcaagcgcaagggcgtgctg
atcggcgacaccgtggtgatccgcaaggccggcgacgtgatccccgaggtgctgggaccc
gtcgtcgaactgcgcgatggctccgaacgcgaattcatcatgcccaccacctgcccggag
tgcggttcgccgttggcgccggagaaggaaggcgacgccgacatccgttgccccaacgcc
cgcggctgcccggggcaactgcgggagcgggttttccacgtcgccagccgcaacggccta
gacatcgaggtgctcggttacgaggcgggtgtggcgctcttgcaggcgaaggtgatcgcc
gacgagggcgacttgttcgcgctgaccgagcaggacttgctgcgcaccgacctgttccgc
accaaggcgggcgaattgtcggccaacggcaaacggctgctggccaacctcgataaggcc
aaggcggcaccgctgtggcgggtgctggtggcgttgtccatccgccatgtcgggccgacg
gcggcccgcgccctggccaccgagttcggcagccttgacgccatcgccgcagcgtccacc
gaccagctggctgcggtcgagggggtggggccgaccattgccgccgcggtcaccgagtgg
ttcgacgtcgactggcaccgcgagatcgtcgacaagtggcgggccgccggggtgcgaatg
gtcgacgagcgtgacgagagtgtgccacgcacgctggccgggctgaccatcgtggtcacc
ggctcgctgaccggtttctcccgcgacgacgccaaggaggcgatcgtggcccgcggcggc
aaggccgccggctcggtgtcgaagaagaccaactatgtcgtcgccggcgactcgccggga
tccaaatacgacaaggcggtggagttgggggtgccgattctggacgaggatgggttccgg
agactgctggccgacggacccgcgtcacgaacgtaa

DBGET integrated database retrieval system