KEGG   Mycobacterium canettii CIPT 140060008: BN44_60510Help
Entry
BN44_60510        CDS       T02419                                 

Definition
(GenBank) Transposase / integrase
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve HTH_23
Motif
Other DBs
NCBI-ProteinID: CCK52999
Position
3402577..3404091
Genome map
AA seq 504 aa AA seqDB search
MKSAEEIMEILEAYDLTGSLRDAAELAGCSHHTVAEYVAARERGELTPGRAARREMLVDP
YLDKLEEWVDRSRGKVRGDVAHEKLVALGYAGSQRTTRRAVAEVKAAYRAGRRRVHRPWI
TEPGMWFQYDFGDGPRVRGVGTQLFCAWLAWCRFRVVLALLDKTLPSVMAAIDTTLRVFG
GVPTYALTDNEKTVTSEHVAGIPVRNAKMLDFARHYGLTIATCVPADPASKGGSENAVKI
AKADLVPCEANLLPEYHSFAELQAACATFCQQVNNRPHRVTRRIPAEMLAEERARLHPLP
AHPYTAAFGVTRTVPPNTAMITFEHGSYSVPHTLCGQTVWVRAHDQQVVVVHLGHAGPVE
VARHQRTTPGNPRVDDAHFPPRPKGPLGRTPRAKTVAEAQFLALGDGAALWLTEAAAAGC
SRIRAKMAGAVDLAALHDRGSVDRALGQAATAGRFGHGDLAAIVAHQAGDPDHHSASQPA
HAGEYNSLAQGTGGWAKLGEQEAN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtctgccgaggagatcatggaaattctggaagcctacgatttgaccggttcgttg
cgtgatgcggcggaactggcggggtgctcgcatcacacggtcgccgagtatgtggccgcg
cgggagcggggcgagttgacgcccgggcgcgcggcgcggcgggagatgctggtggatccg
tatctggacaagctcgaggagtgggtcgaccgctcgcggggcaaggtccgcggcgatgtc
gcccacgagaagctggtcgcgttggggtatgcgggttcgcagcgtacgacacggcgggcg
gtcgccgaggtcaaggcagcgtatcgggcggggcgacggcgggtgcaccgtccgtggatc
accgagccggggatgtggtttcagtacgacttcggggatggcccgcgcgtgagaggtgtt
ggcacgcaattgttttgcgcgtggctggcgtggtgccggtttagggtggtgctggcgctt
ttggataagacactgccatcggtgatggccgcgatcgatacaacgctacgcgtcttcggt
ggggtgcccacctacgcgttgaccgataacgagaagaccgtgaccagcgagcatgtcgcg
gggataccggtgcgcaacgccaagatgctggacttcgcccgccattacgggctcacgatc
gccacctgcgtgccggccgatccggccagcaagggcggctcggaaaacgcggtcaagatc
gccaaggccgatctggtgccctgtgaggccaacctgctaccggaataccacagtttcgcc
gagctgcaagcggcgtgcgcgacgttttgccagcaggtcaacaatcgcccgcatcgggtc
acgcggcgcatcccggcggagatgctggccgaggaacgcgcccggttacacccgttaccc
gcccatccctacaccgcggcgttcggggtgacccgcacggtgccgcccaacaccgcgatg
atcacctttgagcacgggtcgtattcggtgccgcacaccttgtgcgggcagacggtgtgg
gtgcgggcccacgaccagcaggtagtggtcgtgcacctcggccatgccggcccagtcgaa
gtcgcccgccaccagcgcaccacgccgggtaacccgcgggtggatgacgcgcatttccca
ccccggcccaaggggccgctgggccgaacaccacgcgcgaaaactgttgctgaggcgcag
tttttggctctcggtgacggggcagcattgtggttgaccgaggccgccgccgcgggatgc
tcgcggattcgggccaagatggccggggcggtcgatttggccgcactgcacgatcggggc
agcgtggaccgcgccttgggccaagccgcgaccgcgggccggttcggccacggcgatctg
gccgccatcgtggcccatcaggccggcgaccccgaccaccacagcgcctcgcagcccgcc
cacgcgggcgagtacaacagcctggcccaaggcaccggtggctgggcgaagctcggtgag
caggaggccaactaa

DBGET integrated database retrieval system