KEGG   Mycobacterium canettii CIPT 140060008: BN44_60512Help
Entry
BN44_60512        CDS       T02419                                 

Definition
(GenBank) Transposase helper protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IstB_IS21 AAA_16 Bac_DnaA AAA_22 AAA_30 PhoH T2SSE MobB AAA_25 AAA RsgA_GTPase AAA_14 AAA_33 AAA_28 AAA_19 AAA_21 DUF2791 AAA_7 DDE_Tnp_IS66_C PIF1 Lon_2 AFG1_ATPase DEAD ABC_tran RNA_helicase ATPase
Motif
Other DBs
NCBI-ProteinID: CCK53001
Position
3404375..3405154
Genome map
AA seq 259 aa AA seqDB search
MSTTTPPPPPLDDELMRLLKRMRLPYIRNAAPELLATAKAQRWDPAEVLKALLTEEVNGR
DRSALAIRRTRAGFPTGKTFAAWDPALSSIPAPTQAALRTLEWIHRRENLVVCGPSGTGK
TFLLEALGQQAVETGLHVAWFSLEQLGALVRRHRADDTVTKAISRILRADLVAVDDIGLL
PVGTDAAEGLYRLVDAAYEKRSIALSSNLHPAGFDELMPKTLATATVDRLLHHAHVCQTS
GDSIRLTQAMAGKGVNALT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaacaacaccgccaccaccaccgctagacgacgagctgatgcggctgctcaag
cggatgcggctgccttacatccgcaacgccgcacccgagctgctggccaccgccaaggcg
caacgctgggaccctgccgaggtgctcaaagcgcttctgaccgaagaggtcaacgggcga
gaccgctccgcgctggccatccgccgcacgcgggccggttttcccaccggtaagaccttc
gccgcgtgggaccccgcactgtcgtccatccccgcacccacccaggccgcgttgcgcacc
ctggaatggatccaccgacgcgaaaacctggtggtctgcgggccgtcgggcaccggcaag
acgttcctgctcgaagccctcggccaacaagccgtcgaaaccgggctccacgtcgcgtgg
tttagcctcgaacaactcggcgccctggtgcgccggcaccgcgccgacgacaccgtcacc
aaagccatcagccgtatcctgcgtgccgatctggtcgcggttgatgacatcggcctgctg
ccggtcggcaccgacgccgccgaagggctctaccggcttgtcgacgccgcttacgagaaa
cgctccatcgcactatcaagcaatcttcacccggcaggattcgacgagttgatgcccaag
acactggccaccgccaccgtcgaccggctcctgcaccacgcccacgtctgccagaccagt
ggcgacagcatccgacttacccaagccatggccggcaagggggtgaacgccttgacctaa

DBGET integrated database retrieval system