KEGG   Mycobacterium canettii CIPT 140060008: BN44_60513Help
Entry
BN44_60513        CDS       T02419                                 

Gene name
esxR
Definition
(GenBank) Conserved exported protein of unknown function, ESAT-6 like protein EsxR (TB10.3) (ESAT-6 like protein 9)
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WXG100 Xpo1
Motif
Other DBs
NCBI-ProteinID: CCK53002
Position
complement(3405310..3405600)
Genome map
AA seq 96 aa AA seqDB search
MSQIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVLSSAWQGDTGITYQGWQTQWNQ
ALEDLVRAYQSMSGTHESNTLAMLARDGAEAAKWGG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagattatgtacaactatccggcgatgatggctcatgccggggacatggccggt
tatgcgggcacgctgcagagcttgggggccgatatcgccagtgagcaggccgtgctgtcc
agtgcttggcagggtgataccgggatcacgtatcagggctggcagacccagtggaaccag
gccctagaggatctggtgcgggcctatcagtcgatgtctggcacccatgagtccaacacc
ctggcgatgttggctcgtgatggggccgaagccgccaagtggggcggctag

DBGET integrated database retrieval system