KEGG   Mycobacterium canettii CIPT 140060008: BN44_60514Help
Entry
BN44_60514        CDS       T02419                                 

Gene name
esxS
Definition
(GenBank) Conserved protein of unknown function, ESAT-6 like protein EsxS
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WXG100 T7SS_ESX_EspC EIIA-man
Motif
Other DBs
NCBI-ProteinID: CCK53003
Position
complement(3405636..3405929)
Genome map
AA seq 97 aa AA seqDB search
MSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAAFQGAHARFVA
AAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgttggatgcccatattccgcagttgatcgcttcgcatacggcgtttgccgct
aaggcggggttgatgcggcatacgatcggtcaggccgagcagcaggcgatgtcggcgcag
gcgtttcatcagggagagtccgcggcggcgtttcagggtgcgcatgcccggtttgtggcc
gcggccgccaaggtcaataccttgctggatatcgcgcaagccaatttgggtgaggccgcg
ggcacgtatgtggccgccgatgccgccgccgcgtccagctacaccgggttttaa

DBGET integrated database retrieval system