KEGG   Mycobacterium canettii CIPT 140060008: BN44_60518Help
Entry
BN44_60518        CDS       T02419                                 

Gene name
trmU
Definition
(GenBank) Putative tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase TrmU
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BN44_60518 (trmU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcq03016]
    BN44_60518 (trmU)
Enzymes [BR:mcq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     BN44_60518 (trmU)
Transfer RNA biogenesis [BR:mcq03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    BN44_60518 (trmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_Me_trans ThiI Asn_synthase NAD_synthase Smoa_sbd QueC
Motif
Other DBs
NCBI-ProteinID: CCK53006
Position
complement(3407942..3409045)
Genome map
AA seq 367 aa AA seqDB search
MKVLAAMSGGVDSSVAAARMVDAGHEVVGVHMALSTAPGTLRTGSRGCCSKEDAADARRV
ADVLGIPFYVWDFAEKFKEDVINDFVSSYARGETPNPCVRCNQQIKFAALSARAVALGFD
TVATGHYARLSGGRLRRAVDRDKDQSYVLAVLTAQQLRRAAFPIGDTPKRQIRAEAARRG
LAVANKPDSHDICFIPSGNTKAFLGERIGVRRGVVVDADGVVLASHDGVHGFTIGQRKGL
GIAGPGPNGRARYVTAIDADTATVHVGDVTDLDVQTLTGRAPVFTAGAAPSGPVDCVVQV
RAHGETVSAVAELIGDALFVQLHAPLRGVARGQTLVLYRPDPAGDEVLGSATIAGTSGLS
TGGNPGA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttctcgccgcgatgagcggtggcgtcgactcgtctgttgctgccgcccgcatg
gtcgatgccggacacgaggtggtcggagtgcacatggcgctatcgaccgcgcccggcacg
ctgcgcaccggctcgcggggctgttgttccaaagaggacgctgcagacgcacgccgcgtc
gccgatgtgctcggaatcccgttttatgtttgggatttcgcagagaagttcaaagaggac
gtgatcaacgacttcgtgtcgtcgtatgcccgcggggaaactccgaacccttgcgtgcgg
tgcaatcagcagatcaagttcgctgctctgtccgccagggctgtggcgttgggtttcgat
acggtggccaccggccactacgcccggctgtcgggtgggcggctgcgccgcgccgtcgac
cgggacaaggatcagtcttatgtgcttgccgtgctcactgcgcagcagctgcgccgcgcc
gcgttcccgatcggcgacacgccgaagcggcagatccgtgctgaggcggcccgccgcggc
ctggcggtcgccaacaagccggatagccacgacatctgcttcataccgtccgggaacacc
aaggcttttttgggtgagcgcatcggggttcgccgtggtgtggtggttgacgcggatggt
gtggtgctggcttcccatgatggggtgcacgggttcaccatcgggcagcgtaagggcctg
ggcatcgccgggccgggcccgaatggtcgtgcgcgctatgtcacggcgatcgacgccgac
accgccaccgttcacgtaggtgacgtgaccgaccttgatgtgcaaacgctgactgggcgt
gcgcccgtcttcaccgccggagccgcgccgtcaggacccgttgactgcgtggtccaagtg
cgtgcgcacggtgaaaccgtcagtgcggtagcggaattgatcggcgatgcgcttttcgtg
cagttgcatgccccgctgcgcggcgtggcgcgcggccagacgctggtgctctaccgacct
gacccagccggtgatgaggtgctcggcagcgcgaccatcgccggcacttcagggttgtcg
actggcggcaaccccggggcttga

DBGET integrated database retrieval system