KEGG   Mycobacterium canettii CIPT 140060008: BN44_60524Help
Entry
BN44_60524        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 Methyltransf_8 Ubie_methyltran MetW NodS Pox_MCEL Methyltransf_32 MTS Methyltransf_9 RrnaAD PrmA
Motif
Other DBs
NCBI-ProteinID: CCK53012
Position
3414236..3415060
Genome map
AA seq 274 aa AA seqDB search
MCAFVPHVPRHSRGDNPPSASTASPAVLTLTGERTIPDLDIENYWFRRHQVVYQRLAPRC
TARDVLEAGCGEGYGADLIAGVARQVIAVDYDETAVAHVRSRYPRVEVMQANLAELPLPD
ASVDVVVNFQVIEHLWDQAQFVRECARVLRGSGLLMVSTPNRITFSPGRDTPINPFHTRE
LNADELTSLLIDAGFVDVAMCGLFHGPRLRDMDARHGGSIIDAQIARAVADAPWPPELAA
DVAAVTTADFEMVAAGHDRDIDDSLDLIAIAVRP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcattcgttccccacgttccccgccatagccgaggcgacaacccgccgtcggcc
tccacggctagccctgcggtgttgacgctgaccggcgagcgcaccatccccgatctggac
atcgagaactactggtttcgccgccaccaggtcgtctaccaacggctggcaccccgctgc
acggcccgcgacgtgctggaagccggctgcggcgagggatatggcgccgacctgatcgcc
ggcgtcgctcgccaggtcatcgcggtggactacgacgagaccgcggtggcccatgtccgt
agccgctatccccgagtggaggtgatgcaagcaaacctggccgaactgccattgcccgac
gcgtcggtagacgtcgtggtcaacttccaggtcatcgagcatctgtgggatcaagcccaa
ttcgttcgcgagtgcgcccgggtactacggggctcgggactgctgatggtgtccaccccc
aaccggatcaccttctctcccggccgcgataccccgatcaacccattccacacccgcgag
ctcaatgccgacgagctcacttcgctgttgatcgacgcgggattcgtcgatgtggccatg
tgcgggttgtttcatggcccacgcctgcgcgacatggacgcccgccacggcggctccatc
atcgacgcacagattgcgcgggcggtggccgacgcaccgtggccacccgagctggccgca
gacgtcgcggcggtcaccaccgccgacttcgagatggtggcagcgggccacgaccgtgac
atcgatgacagcctggatctgatcgcgatcgcggtgcggccttga

DBGET integrated database retrieval system