KEGG   Mycobacterium canettii CIPT 140060008: BN44_60531Help
Entry
BN44_60531        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ_3 PQQ
Motif
Other DBs
NCBI-ProteinID: CCK53017
Position
3420621..3421703
Genome map
AA seq 360 aa AA seqDB search
MAAGPALSARGYLALNGQTPAGCSLMEWQNDNNGRQRWCVRLVQGGGFAGPLFDGFDNLY
VGQPGAIISFPPTQWTRWRQPVIGMPSTPRFLGHGRLLVSTHLGQLLVFDTRRGMVVGSP
VDLVDGIDPTDATRGLADCAPARPGCPVAAAPAFSSVNGTVVVSVWQPGEPAAKLVGLKY
HAEQLVREWTSDAVSAGVLASPVLSADGSTVYVNGRDHRLWALNAADGKAKWSAPLGFLA
QTPPALTPHGLIVSGGGPDTALAAFRDAGDHAEGAWRRDDVTALSTASLAGTGVGYTVIS
GPHHDGTPGLSLLVFDPANGHTVNSYPLPGATGYPVGVSVGNDRRVVTATSDGQVYSFAP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttggctgccggaccagccctgagcgcacgcgggtacctcgcgttaaacgggcagaccccg
gccgggtgttcgctgatggagtggcagaacgacaacaacggccggcagcgctggtgtgtg
cggctggtccagggcggcggcttcgccggcccgttgttcgacggcttcgacaacctctat
gtcggccagccgggagcgataatctcctttccgccgacccagtggacgcgctggcgccag
cccgtgatcgggatgccgtccaccccgcggtttctggggcatggtcgcctgctcgtgagt
acacacctggggcagctgctggtattcgatacccgccgcggcatggtggtcggcagtccg
gtggacctggtggacggcatcgatcccaccgatgcgacacgcggactggccgactgtgcg
ccggcccggccgggctgcccggtcgcggccgcccctgcgttctcgtcggtcaacgggacg
gtggtggtcagcgtctggcagccgggcgaaccggccgcgaagctggtcgggctgaaatac
cacgctgagcaactcgtccgcgagtggaccagtgacgctgtcagcgcgggcgtgctggcc
agcccggtgctctccgccgacggatcgacggtctacgtcaatgggcgcgaccaccggcta
tgggcactcaacgccgccgacgggaaagcgaagtggtcagctcccctgggctttctggcg
cagacgccgcccgcactgaccccacatggactgatcgtgtccggcgggggccccgacacc
gcgctggcggcgttccgggatgccggtgatcacgccgagggggcctggcgacgcgacgac
gttactgcgctgtcgaccgcgagtctggccggcaccggcgtcggctatacggtcatcagc
ggtccacaccacgatggcacgcccggtttgtcgttgctggtcttcgatccggccaacggc
cacacggtcaacagctatccgctacccggagcgaccggctatcccgtcggggtatcggtt
ggcaacgaccgccgggtggtgaccgccaccagcgacggccaggtctacagcttcgcacct
tag

DBGET integrated database retrieval system