KEGG   Mycobacterium canettii CIPT 140060008: BN44_60533Help
Entry
BN44_60533        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thump_like Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CCK53019
Position
complement(3422456..3423532)
Genome map
AA seq 358 aa AA seqDB search
MRARFGDRAPWLVETTLLRRRAAGKLGELCPNVGVSQWLFTDEALQQATAAPVARHRARR
LAGRVVHDATCSIGTELAALRELAVRAVGSDIDPVRLAMARHNLAALGMEADLCRADVLH
PVTRDAVVVIDPARRSNGRRRFHLADYQPGLGPLLDRYRGRDVVVKCAPGIDFEEVGRLG
FEGEIEVISYRGGVREACLWSAGLAGSGIRRRASILDSGEQIGDDEPDDCGVRPAGKWIV
DPDGAVIRAGLVRNYGARHGLWQLDPQIAYLSGDRLPPALRGFEVLEQLAFDERRLRQVL
SALDCGAAEILVRGVAIDPDALRRRLRLRGSRPLAVVITRIGTGSLSHVTAYVCRPSR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcccggtttggcgatcgggcgccgtggctggtggagacgacgctgctgcgccgc
cgcgccgccggcaaactgggcgagctgtgcccgaacgttggggtgtcgcaatggctattc
accgatgaggcgctgcagcaggctaccgcagcacccgtggcccggcaccgggccaggcga
ctggccggtcgggtagtgcacgacgcgacctgctccatcggcaccgagctggccgcgctg
cgcgagctagctgtccgggcggtcggcagcgatatcgacccggtgcggctggccatggcg
cgccacaacctggccgccctgggaatggaagctgacctgtgccgcgccgatgtgctgcat
ccggtgacccgcgacgcggtcgtcgtcatcgacccggcgcgtcgcagcaacgggcggcga
cgcttccacctcgccgactaccagcccggcctgggcccactactggaccgctaccgcggc
cgtgatgtggtcgtcaagtgcgctcccggaatagatttcgaggaggtgggccggctcggt
ttcgagggcgagatcgaggtgatctcataccgcggtggggttcgagaagcatgtctttgg
tcggccgggttggccggatcgggtatccgccgtcgagccagcatcctcgattccggtgaa
caaatcggtgacgacgagcccgacgactgcggtgtgcggcccgccgggaaatggatcgtc
gaccccgacggcgccgtcatccgtgccggcctggtacgcaactacggcgcccggcatggg
ctgtggcagctcgatccccaaatcgcttacctgtccggtgaccggctgccgcctgcgttg
cgcgggttcgaggtgctcgagcagctggccttcgacgagcgtcggctgcgtcaggtgctg
tcagcgctggattgcggggcagccgaaatcctggtgcgcggcgttgcgatcgatcccgac
gctctgcggcgacggctccggctgcggggcagcagaccgctggcggtggtcatcacccgc
atcggtaccgggtccttgagccatgtgaccgcctatgtgtgtcggccgtcccggtag

DBGET integrated database retrieval system