KEGG   Mycobacterium canettii CIPT 140060008: BN44_60537Help
Entry
BN44_60537        CDS       T02419                                 

Gene name
ylmA
Definition
(GenBank) Putative uncharacterized ABC transporter ATP-binding protein YlmA
  KO
K02013  iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN44_60537 (ylmA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcq02000]
    BN44_60537 (ylmA)
Enzymes [BR:mcq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     BN44_60537 (ylmA)
Transporters [BR:mcq02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BN44_60537 (ylmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_27 AAA_23 SMC_N AAA_22 IstB_IS21 DUF3584 cobW AAA_30 AAA_29 AAA AAA_15
Motif
Other DBs
NCBI-ProteinID: CCK53023
Position
complement(3426297..3427160)
Genome map
AA seq 287 aa AA seqDB search
MRHDSRVLDNGGPDAADPDLLIDFRNVSLRRYGRTLVGPLDWAVELDERWVIVGPNGAGK
TSLLRIAAAAEHPSSGVAFVLGERLGRVDVSELRARVGLSSSALAERVPGDERVRDLVVS
AGYAVLGRWRERYEAVDYHRAIDMLESLGAEHLANRTYGTLSEGERKRVLIARALMTDPE
LLLLDEPAAGLDLGGREELVARLADLAADPDAPALVLVTHHVEEIPPGFSHCLLLSEARV
VAAGLLPDALTAENLSTAFGQEITLEVADGRYFARRRRSRAAHRRQS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcggcacgatagtcgggtgctcgacaacggcggccctgatgcggccgaccccgacctg
ctgatcgacttccgaaacgtgtccctgcgccgttatgggcgcacgctggtcggcccgctg
gattgggcggtcgaactcgacgaacgctgggtgatcgtcggccccaacggggccggcaag
acgtcattgctgcgcattgccgccgcggctgagcatccgtcgtcgggcgtggcctttgtg
ctcggtgagcggctaggccgggttgacgtctcggaactgcgtgctcgggtcgggctcagt
tcctcggcgctggcggagcgggtgcccggcgatgaacgcgtccgcgatcttgtcgtctcc
gccggctatgcagtgttgggccggtggcgcgagcgctacgaggccgtcgactaccaccgc
gcgatcgacatgctggagagcctgggcgctgagcatttggccaaccgcacatacggaaca
ctgtcggagggcgagcgcaagcgagtgctgattgcgcgggctttgatgacagatccagag
ctgctgctgctcgacgaacccgccgccggcctggacttaggtggccgagaggaattggtc
gcccggctggccgacctggcagccgaccctgacgcgcccgcgctggttctggtcacccac
cacgtcgaggagattccgcccggcttcagccattgcctgctgctgtcggaggcccgggtg
gttgccgcgggcttgcttcccgacgcgctgaccgccgagaacctgtccaccgcgtttggc
caggagatcacgctggaggtggccgacgggcgatatttcgcccgacggcgtcgcagccga
gcagcccatcggagacagtcatga

DBGET integrated database retrieval system