KEGG   Mycobacterium canettii CIPT 140060008: BN44_60543Help
Entry
BN44_60543        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3349
Motif
Other DBs
NCBI-ProteinID: CCK53028
Position
complement(3432556..3432930)
Genome map
AA seq 124 aa AA seqDB search
MTKTFSHPHFFRSVLRWLQVGYPEGVPGPDRVALLSLLRSTPLTEEQIGEVVRHFTENGS
PAVADRVIDRDEIAEFISEVTHHDPGPENIQRVAGILAAAGWPLAGVDVGESESGSDRAP
ASQG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaaacgttctcgcacccgcatttcttccgttcggtgctgcgctggcttcaggtt
ggctaccccgagggcgtccccgggccggaccgggtggcgctgctgtcgctattgcgcagc
accccgctgaccgaggagcagatcggggaggtggtgcgccacttcaccgagaacgggtcg
cccgccgtggcggaccgtgtgatcgaccgcgacgagatcgccgagttcatctccgaggtg
acccatcacgaccccggaccggaaaacatccaacgggtggcaggcatcctggccgccgcc
ggatggccgctggccggcgtcgacgtcggcgagtccgaatccggaagtgatcgcgcaccg
gcctcacagggctga

DBGET integrated database retrieval system