KEGG   Mycobacterium canettii CIPT 140060008: BN44_60547Help
Entry
BN44_60547        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function, possible phage capsid protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_capsid DUF2184
Motif
Other DBs
NCBI-ProteinID: CCK53032
Position
complement(3434263..3435381)
Genome map
AA seq 372 aa AA seqDB search
MVETTAANPQLLADQVSALLVQPLEAASVVLSSGPRIFDTSGVLRIPKLTKSSTVGFIGE
NELIPSDHDTTFDEVVLMPTDRKSIKVIERYSRELARQAVIGIDATLKNRLVKVVSDKLD
LALLTGAGQATNEVQVITVTGDPFTVSFRGVSTAGLADDADAATVEAALQGLSTIGAGNA
TVAGSAGGPYTVTFAGALAATAVDQLEATNATVTTTTEGEAANGIKGLINQPGVQTGTLD
VTDADSLLDAIALASAAEVMPNRWFVNGTDFIALRKLKTNDTDSKQYLLESDVTSGPTYR
LFGVPVTVTNKLKAGTAVLADVSQVAVARDMAPSVTILSERYADYDQIGIRVVTRYDLGL
LHPQAVIVLTAA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagacgaccgccgctaacccgcagttgctggccgatcaggtgtcggcgctgctc
gtacagcccctcgaagccgcaagtgttgtgctctcatccgggcccaggatcttcgacacc
tctggcgtgctccgcattcccaagctgaccaagtcctcgacggtcggcttcatcggcgaa
aacgagctgatcccctccgatcacgacacgactttcgatgaggtcgtactgatgcccacg
gaccgcaagagcatcaaagtgatagaacgatacagccgcgaactcgcgcgacaggccgtc
atcggcatcgacgccaccctcaagaaccgcttggtgaaagtggtctcggacaagctggac
ctcgcgctgctcaccggcgccggccaagccaccaacgaggtacaggtcatcaccgtcacc
ggcgacccgttcacggtgtcgttccgcggcgtgagcaccgccggtttggctgacgacgcc
gacgcggccaccgtcgaagccgccttgcagggcctgtcgacgatcggggccggtaacgcc
accgtcgccggcagcgcaggcggcccctacacggtgaccttcgccggcgccctggccgcc
accgccgtcgaccagctcgaggccaccaacgcaaccgtgacaaccaccaccgaaggtgaa
gccgccaacggcatcaagggcctgatcaaccagccgggtgtacaaaccgggacgctggat
gtcaccgacgccgacagcctcttggacgctatcgcgctggcatcggcggccgaagtcatg
ccgaacaggtggttcgtcaacggcaccgacttcatcgcgttgcgcaagctgaagacgaat
gacacggattcaaagcagtatttgcttgaatccgatgtcacgtccgggcccacctaccgg
ctgttcggtgtacccgtcactgtgacgaataagctcaaggcgggtacggcggtcctggcc
gacgtctcccaagtggccgtagcccgcgacatggccccgtccgtgaccatcctctccgaa
cgctatgccgactatgaccagatcgggattcgggtggtcacccgctacgacctcgggtta
ctgcacccgcaggccgtcatcgtcctcacggccgcctaa

DBGET integrated database retrieval system