KEGG   Mycobacterium canettii CIPT 140060008: BN44_60576Help
Entry
BN44_60576        CDS       T02419                                 

Gene name
cstA
Definition
(GenBank) Putative carbon starvation protein A homolog CstA
  KO
K06200  carbon starvation protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BN44_60576 (cstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CstA CstA_5TM
Motif
Other DBs
NCBI-ProteinID: CCK53058
Position
3463563..3465839
Genome map
AA seq 758 aa AA seqDB search
MAAPTPSNRIEERSGHASYVRTDADLPPVAILGRSPITLRHKIFFVAVAVIGALAWTVVA
FFRNEPVNAVWIVVAAGCTYIIGFRFYARLIEMKVVRPRDDHATPAEILDDGTDYVPTDR
RVVFGHHFAAIAGAGPLVGPVLATQMGYLPSSIWIVVGAVLAGCVQDYLVLWISVRRRGR
SLGQMVRDELGATAGVAALVGIPVIITIVIAVLALVVVRALAKSPWGVFSIAMTIPIAIF
MGCYLRFIRPGRVSEVSLIGIGLLLLAVVSGDWVAHTSWGAAWFSLSPVTLCWLLISYGF
AASVLPVWLLLAPRDYLSTFMKVGTIALLAIGVCAAHPIIEAPAVSKFAGSGNGPVFAGS
LFPFLFITIACGALSGFHALICSGTTPKMLEKEGQMRVIGYGGMMTESFVAVIALLTAAI
LDQHLYFTLNAPSLHTHDSAATAAKYVNGLGLTGSPVTPDHISQAAASVGEQTIVSRTGG
APTLAFGMAEMLHRVVGGVGLKAFWYHFAIMFEALFILTTVDAGTRAARFMVSDALGNFG
GVLRKLQNPSWRPGAWACSLVVVAAWGSILLLGVTDPLGGINTLFPLFGIANQLLAGIAL
TVITVVVIKKGRLKWAWIPGIPLLWDLAVTLTASWQKIFSADPSVGYWTQHAHYAAAQHA
GETAFGSATNADEINDVVRNTFVQGTLSIVFVVVVVLVVVAGVIVALKTIRGRGIPLAED
DPAPSTLFAPAGLIPTAAERKLQRRLGAPASASVAAPD
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcgccgaccccgtcgaatcggatcgaagaacgctccggacacgccagctacgtc
cgcaccgatgccgacctgccacccgtggccatcctcggtcgctcccccatcacgcttcgg
cacaagatcttcttcgtggccgttgccgtgatcggcgctctcgcctggaccgtcgtcgcg
ttcttccgcaacgagccggtcaacgcggtctggatcgtggtcgcagcgggctgcacctac
atcatcgggttccggttttatgcgcggctgatcgaaatgaaagtcgtccgtccccgcgac
gatcacgccaccccggccgaaatcctcgacgacggcaccgactacgtgcccaccgaccgg
cgggtggtattcggacaccacttcgccgccatcgccggtgccgggccgcttgtcggacca
gtactggccacccagatgggttacttacccagcagcatctggattgtcgtcggcgcggtg
ctggccggatgtgtccaggactacctggtgttgtggatctccgtgcggcggcgtggccgc
tccctgggtcagatggttcgcgacgaactcggcgccaccgccggagtggccgccctcgtt
ggaatcccggtcattatcaccattgtgatcgcggtgctggcgctggtggtcgtgcgggcg
ctggccaagagcccgtggggcgtgttctcgatcgccatgaccatccccatcgccatcttc
atgggctgctacttgcggttcatacgtcccgggcgggtgtcggaagtttcattgatcggg
atcggactgctgctgctcgccgttgtctccggtgattgggttgcccatacctcctggggc
gcagcgtggttcagcttgtcaccggtgacactgtgttggcttctcatcagctatggcttc
gcagcctcggtgctgccggtgtggctgctgctcgcgccacgcgactacctgtcaacgttc
atgaaggtcggcaccatcgcgttgctcgcgataggtgtttgtgcggctcacccgatcatc
gaggcccctgcggtgtcgaaattcgccggtagcggcaacggcccggtgttcgccggctca
ctgtttccattcctgttcatcaccatcgcgtgcggggcgctgtctggattccacgcgctc
atctgctcgggcacgacgccgaagatgctggagaaggaaggccagatgcgcgtgatcggc
tacggcggcatgatgaccgagtccttcgtcgccgtcatagcactactcaccgcggcgatc
ctcgaccagcacctatacttcaccctcaacgcgccgtccctgcatacccacgacagcgca
gccaccgccgccaagtacgtcaacgggctcggtttgacgggctcaccggtgaccccagac
cacatcagccaggccgccgccagcgtcggcgaacagacgatcgtgtcgcgcaccggcggt
gcgccgacgctggcgttcggcatggcggagatgctgcatcgagtggtcggcggtgtgggc
ctcaaggcgttctggtatcacttcgcgatcatgtttgaggctctgttcatcctcaccacc
gtcgacgccggcaccagggccgcgcgcttcatggtctccgatgcgctgggcaactttggc
ggtgtactgcgcaaactgcagaatccgagctggcgtcccggtgcgtgggcatgcagtttg
gtggtcgtcgcggcgtggggcagcatcctgctgctcggtgtgaccgatccgctgggcggc
atcaacacgctgttcccgctgttcggcattgccaaccagttgcttgccggaattgcgctg
accgtcatcaccgtcgtcgtcatcaagaaggggcgactgaagtgggcttggataccgggt
attccactgctgtgggatctggcggtcaccctgaccgcatcgtggcagaagatcttctcc
gctgatccttctgtcggctactggactcagcatgctcactacgcggcagcccagcacgca
ggcgagaccgcgttcggctcggccaccaacgccgatgagatcaacgacgtcgtccggaac
acattcgtccagggcaccctgtcgatcgtcttcgtggtggtcgtcgtgctggttgttgtc
gccggagtcatagtggcgctgaagacaattcgcggccgcggcataccgttggccgaggac
gatccggcgccgtcgacgttgttcgcgcccgctggcctgattcctacagccgcagagcga
aagttgcaacgacgtttgggcgcgccggcctcggcttccgtcgcggcgcccgactag

DBGET integrated database retrieval system