KEGG   Mycobacterium canettii CIPT 140060008: BN44_60581Help
Entry
BN44_60581        CDS       T02419                                 

Gene name
pgm
Definition
(GenBank) Phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00010  Glycolysis / Gluconeogenesis
mcq00030  Pentose phosphate pathway
mcq00052  Galactose metabolism
mcq00230  Purine metabolism
mcq00500  Starch and sucrose metabolism
mcq00520  Amino sugar and nucleotide sugar metabolism
mcq00521  Streptomycin biosynthesis
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01120  Microbial metabolism in diverse environments
mcq01130  Biosynthesis of antibiotics
Module
mcq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN44_60581 (pgm)
   00030 Pentose phosphate pathway
    BN44_60581 (pgm)
   00052 Galactose metabolism
    BN44_60581 (pgm)
   00500 Starch and sucrose metabolism
    BN44_60581 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BN44_60581 (pgm)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN44_60581 (pgm)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN44_60581 (pgm)
Enzymes [BR:mcq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BN44_60581 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CCK53063
Position
complement(3468035..3469678)
Genome map
AA seq 547 aa AA seqDB search
MVANPRAGQPAQPEDLVDLPHLVTAYYSIEPDPDDLAQQVAFGTSGHRGSALTGTFNELH
ILAITQAIVEYRAAQGTTGPLFIGRDTHGLSEPAWVSALEVLAANQVVAVVDSRDRYTPT
PAISHAILTYNRGRTEALADGIVVTPSHNPPSDGGIKYNPPNGGPADTAATTAIAKRANE
ILLARSMVKRLPLARALRTAQRHDYLGHYVDDLPNVVDIAAIREAGVRIGADPLGGASVD
YWGEIAHRHGLDLTVVNPLVDATWRFMTLDTDGKIRMDCSSPDAMAGLIRTMFGNRERYQ
IATGNDADADRHGIVTPDEGLLNPNHYLAVAIEYLYTHRPSWPAGIAVGKTVVSSSIIDR
VVAGIGRQLVEVPVGFKWFVDGLIGATLGFGGEESAGASFLRRDGSVWTTDKDGIIMALL
AAEILAVTGATPSQRYHALAGEYGGPCYARIDAPADREQKARLARLSADQVSATELAGEP
ITAKLTTAPGNGAALGGLKVTTANAWFAARPSGTEDVYKIYAESFRGPQHLVEVQQTARE
VVDRVIG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaacccacgagccggtcaaccggcccagcccgaagacctcgtcgacctgccc
catctggtgactgcgtactactcgatcgaacccgatcccgacgacctcgctcaacaggtc
gctttcggcacctcagggcaccggggctcagccctgaccggaacgttcaacgaactacat
attctggccatcacccaggctatcgtcgaataccgcgccgcccaggggaccaccgggccg
ctgttcatcggccgtgacacccatggcctttcggaaccggcatgggtatcggcgctggag
gtactcgccgccaatcaggtggtggccgtcgtcgactcccgcgaccgctacacgccgacg
ccggcaatcagccacgccatcttgacctacaaccgcggccggaccgaagcgctggccgac
gggatcgttgtgacgccgtcgcacaacccgccgtccgacggcggcatcaagtacaaccca
cccaacggtggcccggcggacaccgctgcgaccaccgcaatagccaagcgtgccaacgag
attctgctcgctcggtcgatggtgaagcggttgccgctggcccgcgcgttacgcaccgcc
cagcgacacgactacctgggccactatgtcgatgacctgccgaacgtggtcgatatcgcc
gccattcgcgaggccggggtgcggatcggcgccgacccgctcggcggggccagcgtggat
tactggggtgagatcgcccaccggcatggcctagacctgaccgtggtcaatccgctggtc
gacgcaacctggcggttcatgaccctggacaccgacgggaagatccggatggactgcagt
tcaccggatgcgatggctgggctcatccgaacgatgttcggcaaccgggagcgctaccag
atcgccaccggcaacgacgccgacgccgaccgacacggcatagtcacccctgacgaaggg
ctgctgaatcctaaccactatctggccgtggccatcgaatatctctacacccaccgcccg
tcctggccggccggcatcgccgtgggcaagacggtggtcagctcgtcgatcatcgaccgg
gtggtcgccgggatcggccgtcaactcgttgaggtaccggtcggattcaaatggttcgtc
gacggtctgatcggcgccaccttgggcttcggcggcgaggaatcggcgggggcatcattt
ctgcgacgggacggatcggtatggaccaccgacaaggacggcatcatcatggcgctgctg
gccgccgagatcctggcggtcaccggggctacgccgtcgcagcgatatcacgcgctggcc
ggcgagtacggtgggccgtgctatgcgcggatcgacgcgcccgccgatcgggagcagaaa
gcccgcctggccaggctgtcggccgaccaggtgagcgccaccgagttggccggtgagccg
atcaccgcaaagctgacgaccgcgcccggcaacggtgctgcgctgggcggattgaaggtg
acgacggccaatgcgtggtttgccgcgcgtccgtcgggcaccgaggacgtctacaagatc
tacgcggagtccttccgtggaccgcaacatctggtcgaggtgcagcagaccgcccgcgaa
gtggtcgatcgggtcatcgggtga

DBGET integrated database retrieval system