KEGG   Mycobacterium canettii CIPT 140060008: BN44_60582Help
Entry
BN44_60582        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
  KO
K06199  fluoride exporter
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcq02000]
    BN44_60582
Transporters [BR:mcq02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN44_60582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRCB
Motif
Other DBs
NCBI-ProteinID: CCK53064
Position
3469748..3470146
Genome map
AA seq 132 aa AA seqDB search
MPNHDYRELAAVFAGGALGALARAALSALAIPDPARWPWPTFTVNVVGAFLVGYFTTRLL
ERLPLSSYRRPLLGTGLCGGLTTFSTMQVETISMIEHGHWGLAAAYSVVSITLGLLAVHL
ATVLVRRVRIRR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaaccacgattatcgcgagttggctgcggttttcgccggcggagcgttgggtgcg
ctggcccgagcagcgctgagcgcactcgccatccccgacccagcccggtggccatggccg
acgttcacggtcaacgtcgtcggcgccttcctggtgggttatttcaccacccggctgctg
gagcgattgcccctgtcgagttatcgacgcccattgctcggcaccggattgtgcggcgga
ctgaccactttctcgacgatgcaggtcgagacgatcagcatgatcgaacacggtcattgg
ggtttggccgctgcctactccgtcgtcagcatcaccctcggattgctggcggtgcacctg
gccacggtcttggtacgccgagtgcggatacgccgatga

DBGET integrated database retrieval system