KEGG   Mycobacterium canettii CIPT 140060008: BN44_60586Help
Entry
BN44_60586        CDS       T02419                                 

Definition
(GenBank) Putative transposase
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 HTH_21 rve_2 HTH_Tnp_Tc3_2 DDE_Tnp_IS240 DDE_Tnp_ISAZ013 HTH_33
Motif
Other DBs
NCBI-ProteinID: CCK53068
Position
3472396..3473172
Genome map
AA seq 258 aa AA seqDB search
MAATIGYLFAKHKRTYGSPRITADLRDMGWRVSVNTVAALMREQGLVARRKRRRHGTTKP
DKSARKAPDLLGRDFSPRDHPNLAWVGDLTEIPTDEGKLHLASVIDLHSRRVPGFAMGVH
HDAALARAALCMAIAVRGGSVAGVIFHTDQGGEYTGELFASACRSARVTQSMGRTGSALD
NAAAESFNSTLEWELLRNNHFHTREEARHAVAAWIDEYNVERRHSTNGMLSPVDYERACG
QQRSEQPAGEQHAQKRAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttggcggccaccatcgggtatctgttcgccaagcacaagcggacctacggatcaccgcgg
attaccgctgacctacgggatatggggtggcgggtgtcggtgaacaccgtcgcggcgctg
atgcgcgagcagggtctggtagcgcggcgcaaacgccgccggcacggcaccacgaaaccg
gacaaatccgcgcgtaaggcccccgatctgctgggccgagacttttccccgcgcgaccac
cccaacctcgcctgggtgggcgatctgaccgaaatccccaccgatgagggcaaactgcac
ctcgcctcagtaattgacctgcattcgcggcgggtgcccgggttcgccatgggggtgcac
catgacgccgcgctggcgcgggcggcgctgtgcatggccattgcggtgcgcggcgggtcg
gtggccggggtcattttccacaccgaccagggcggtgaatacaccggcgaactgttcgcc
agcgcttgccgatccgctcgcgtcacccaatcgatggggcgtaccgggtcggctctcgac
aacgcggccgcggaatcgttcaactcgaccctggaatgggaattgttgcgcaacaaccac
ttccacacacgtgaagaggcacgtcacgcggtcgccgcctggatcgacgagtataacgtt
gaacgtcggcattccacgaacggcatgctcagccccgtcgactacgaacgcgcctgtggt
caacaacggagtgagcaaccagccggtgaacagcacgcccagaaacgggcggcatga

DBGET integrated database retrieval system