KEGG   Mycobacterium canettii CIPT 140060008: BN44_60591Help
Entry
BN44_60591        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
  KO
K01644  citrate lyase subunit beta / citryl-CoA lyase [EC:4.1.3.34]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN44_60591
Enzymes [BR:mcq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     BN44_60591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: CCK53073
Position
complement(3475641..3476564)
Genome map
AA seq 307 aa AA seqDB search
MTSMYEQVDTNTADPVAGSRIDPVLARSWLLVNGAHGDRFESAAHSRADIVVLDIEDAVA
PKDKHAARDNAVRWFGDGNADWVRINGFGTPWWADDLAMLADSPVGGVMLAMVESVDHVT
ETAKRLPNVPIVALVETARGLERINEIAAAKGTFRLAFGIGDFRRDTGFGEDPATLAYAR
SRFTIAARAAGLPSAIDGPTIGSNALKLIEATAVSAEFGMTGKICLSPDQCPVVNEGLSP
SQDEIVWAKEFFAEFARDGGEIRNGSDLPRIARATKILDLARAYGIEVSDFEDEPVHMPA
PTDTYHY
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaatgtatgaacaggtcgataccaacacggcggatccggtggccgggtctcgt
atcgatccggttctcgcgcggagttggttactggtcaacggcgcgcacggcgaccggttc
gagtccgccgcgcactcacgcgccgacatcgtcgtgctcgatatcgaggacgcggtcgct
cccaaagacaagcatgccgcccgggacaacgccgtgcgttggtttggtgacggaaacgct
gactgggtgcgcatcaacggcttcggcacaccttggtgggcggacgatctagcgatgttg
gccgatagccccgttggcggagtgatgctggcgatggtcgaatcggtggaccatgtcacc
gagaccgcgaaacgactacctaacgtgccgatcgttgcactggtcgaaacggcgcggggt
ctggagcgcatcaacgagattgctgcggccaagggcaccttccggctcgccttcggtatc
ggcgactttcgccgggacaccggctttggcgaagacccggcaacattggcctacgcgcgg
tcgcgctttaccatcgcggcccgggccgccggtctgcccagcgcgatcgacgggccgacc
atcggctccaacgcgctcaagctgatcgaggccacggccgtctccgccgagtttggcatg
accggcaagatctgcctttcgccggaccaatgtccggtggtgaatgaggggctatccccg
tcgcaggacgaaatcgtctgggcgaaggaatttttcgctgagttcgcccgcgacgggggc
gagatccgcaacgggtctgacctgccgcgcattgcccgggccaccaagatcctcgatctg
gcccgcgcctacggcatcgaagtgtccgacttcgaggacgaaccggttcacatgccggct
ccgactgacacctaccactactag

DBGET integrated database retrieval system