KEGG   Mycobacterium canettii CIPT 140060008: BN44_60594Help
Entry
BN44_60594        CDS       T02419                                 

Gene name
hab
Definition
(GenBank) Putative hydroxylaminobenzene mutase Hab
  KO
K01865  (hydroxyamino)benzene mutase [EC:5.4.4.1]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00627  Aminobenzoate degradation
mcq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN44_60594 (hab)
Enzymes [BR:mcq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.1  (hydroxyamino)benzene mutase
     BN44_60594 (hab)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIG-14_Wnt-bd
Motif
Other DBs
NCBI-ProteinID: CCK53076
Position
3478944..3479345
Genome map
AA seq 133 aa AA seqDB search
MQKLLFTIGLALFLIGLLTGLVIPALKNPRMALSSHLEGVLNGMFLVVLGLLWPHIDLPE
AWQVIAVALIVYSAYANWLATLLAAAWGAGRKFAPIATGDHEASTAKEGFVSFLLLSLSV
AIVIGVVIVIIGL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaagctgctattcaccatcgggttggccctgttcctgatcggcctgcttaccgga
ttggtcatcccggcactgaagaacccgcgcatggcgctgtcgagccacctcgagggggtc
ctcaacgggatgttcctcgtcgtgctcggcctgctctggccgcacatcgatctgcccgag
gcatggcaggttatcgcggtggcgctgatcgtttactccgcctacgccaactggctggcg
accctgctcgcggcggcctggggagcgggccgtaaattcgcgcccatcgcgaccggcgac
cacgaagcctcaaccgccaaggagggattcgtcagctttctgttgttgtccctctcggtg
gccatcgtgatcggcgtggtcatcgtcatcattggcctctga

DBGET integrated database retrieval system