KEGG   Mycobacterium canettii CIPT 140060008: BN44_60599Help
Entry
BN44_60599        CDS       T02419                                 

Definition
(GenBank) Putative monooxygenase (hydroxylase)
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMO-like Pyr_redox_2 K_oxygenase NAD_binding_8 Pyr_redox_3 DAO Thi4 NAD_binding_9 FAD_oxidored MCRA
Motif
Other DBs
NCBI-ProteinID: CCK53081
Position
3486095..3487582
Genome map
AA seq 495 aa AA seqDB search
MNQHFDVLIIGAGLSGIGTACHVTAEFPNKTIALLERRERLGGTWDLFRYPGVRSDSDMF
TFGYKFRPWRDVKVLADGASIRQYIADTATEFGVDEKIHYGLKVNTAEWSSRQCRWTVAG
VQEATGETRTYTCDYLISCTGYYNYDAGYLPDFPGVDRFGGRCVHPQHWPEDLDYAGKKV
VVIGSGATAVTLVPAMAGSNPGSAAHVTMLQRSPSYIFSLPAVDKISEVLGRFLPDRWVY
EFGRRRNIAIQRKLYQACRRWPKLMRRLLLWEVRRRLGRSVDMSNFTPNYLPWDERLCAV
PNGDLFKTLASGAASVVTDQIETFTEKGILCKSGREIEADIIVTATGLNIQMLGGMRLIV
DGAEYQLPEKMTYKGVLLENAPNLAWIIGYTNASWTLKSDIAGAYLCRLLRHMADNGYTV
ATPRDAQDCALDVGMFDQLNSGYVKRGQDIMPRQGSKHPWKVLMHYEKDAKILLEDPIDD
GVLHFAAAAQDHAAA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcatttcgacgtcctgatcatcggcgccggcctgtccggcatcgggacggcc
tgtcacgtgacggccgagttccccaacaagacaatcgccctcttggagcgacgggagcgc
ctgggcggcacctgggacttgttccgctacccgggagttcgttcggactccgacatgttc
accttcggctacaagttccgcccgtggcgcgacgtgaaggtgctcgccgacggcgcgtcg
atccggcagtacatcgccgacaccgccacggagttcggcgtcgacgagaagattcactac
ggcctgaaggtcaacaccgccgagtggtcgagccggcagtgccgttggaccgtcgcgggc
gtgcaggaggcgaccggcgaaacccggacctacacctgcgactacctcatcagctgcacc
ggctactacaactacgacgcgggttatctgccggacttccccggcgtggaccggttcggc
ggccggtgcgtgcacccgcagcactggcccgaagacctcgattacgccggcaagaaggtc
gtcgtcatcggcagcggcgcaacggcggtcactttggttccggcgatggccggctccaac
cccggcagtgccgcgcacgtgacgatgctgcagcgatccccgtcgtacatcttctcgctg
ccggcggtcgacaagatctccgaagtcctgggccgcttcctgccggatcgctgggtctac
gagtttggccgcaggcgcaacatcgccatccagcgaaagctctaccaggcctgccggcgc
tggcccaagctgatgcggcgattgctgctgtgggaggtacgacgccgcctcggccgctcc
gtggacatgagcaacttcaccccgaactacctgccgtgggacgagcggttgtgcgcggtg
cccaacggcgatctgtttaagacgctggcctcgggcgcggcgtcggtggtgaccgatcag
atcgagaccttcaccgagaagggcatcctgtgcaagtccggccgggagatcgaggccgac
atcatcgtcaccgcgaccggtctgaacatccagatgctgggcgggatgcgactcatcgtg
gacggcgccgaataccagctgccggagaagatgacctataagggtgtgctgctggaaaac
gcccccaatctggcctggatcatcggctacaccaacgcgtcatggaccctgaagtccgac
atcgccggcgcctatctgtgccggctgctgcggcacatggccgacaacggctacacggtg
gcaacgccgcgcgatgcgcaggactgcgcgctggacgttggcatgttcgaccagctgaac
tccggctatgtgaagcgcggccaggacatcatgccgcgccagggatccaagcacccgtgg
aaggtgctcatgcactacgagaaggacgccaagatcctgctcgaagaccccatcgatgac
ggcgtgctgcacttcgccgcagcggcccaagaccacgcggcggcctga

DBGET integrated database retrieval system