KEGG   Mycobacterium canettii CIPT 140060008: BN44_60618Help
Entry
BN44_60618        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MDMPI_N MDMPI_C DinB_2 DUF664
Motif
Other DBs
NCBI-ProteinID: CCK53098
Position
complement(3506005..3506856)
Genome map
AA seq 283 aa AA seqDB search
MTTPGRPLTTLDKSDVLAGLFAVWHSLDALLDGLLETDWQATSPLPGWDVKAVVSHIIGT
ESFLLGIAAPEPDTDVSALAHVRNPIGVMNECWVRHLGTESGVGLLERFRAVTSQRRKVL
ASLSDDEWNAPTTTPSGPDSYGRFMRIRIFDCWMHEQDIRAAVQRPSSDDELGGPASPLV
LDEIAATMGFVVGKLAKAPDGSRVLLELTGPLSRSIRVSVDGRARVVDDFGGPAPTATIR
LDGLQFTRLAGGRPMSPARSQDVELGGDKELAGHILERLNFVI
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacaccgggccgtccccttaccacactggacaagtccgacgtgctggccgggctg
ttcgccgtttggcactccctggatgcgctgctcgatggactgctcgagacggactggcag
gcaacgagtccgctgcccggttgggacgtcaaggccgtggtgtcgcacatcatcggcacc
gagtcatttctgctcggcatcgccgcaccagaaccagacacagacgtctctgcgcttgcg
catgtccgcaaccccatcggcgtgatgaacgagtgctgggtgcgtcatctgggcacagaa
tcgggtgtgggcttgctggagcggtttcgcgcagtgactagccagcgccgcaaggtctta
gcgagcctttccgatgacgaatggaatgcgccgacgaccaccccctcgggccccgacagc
tacgggcggttcatgcggatacgcatcttcgactgctggatgcacgaacaggacatccgc
gcggcggtgcagcgcccgtcgtccgacgacgaactcggcgggccggcgtcaccgctggtc
ctcgatgagatagcggccaccatggggttcgtcgtcggcaagctggccaaagcgcccgac
ggctcccgcgtgctgttggagctgaccggcccgctgtctcgcagcatccgcgtttccgtg
gacggtcgagcgcgggtggtcgacgacttcggtgggccggcgccgacggcgacgatccgc
ctggacggactgcagttcaccaggctcgccggcgggcgcccgatgagcccggcgcgcagc
caggatgtggaactcggcggcgacaaggagctggccggtcacatcctcgagcgcctgaac
ttcgtgatctga

DBGET integrated database retrieval system