KEGG   Mycobacterium canettii CIPT 140060008: BN44_60621Help
Entry
BN44_60621        CDS       T02419                                 

Gene name
ftsE
Definition
(GenBank) Transporter subunit: ATP-binding component of ABC superfamily
  KO
K09812  cell division transport system ATP-binding protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq02010  ABC transporters
Module
mcq_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN44_60621 (ftsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcq03036]
    BN44_60621 (ftsE)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcq02000]
    BN44_60621 (ftsE)
Chromosome and associated proteins [BR:mcq03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BN44_60621 (ftsE)
Transporters [BR:mcq02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    BN44_60621 (ftsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_33 SMC_N AAA_29 RsgA_GTPase AAA_22 AAA_15 AAA_25 AAA_18 RNA_helicase AAA_5 ATPase_2 AAA_30 Zeta_toxin AAA_23 AAA_24 AAA PhoH MMR_HSR1 NACHT AAA_28 DUF87 DUF3987 TsaE Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: CCK53101
Position
complement(3508272..3508961)
Genome map
AA seq 229 aa AA seqDB search
MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDV
RVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDNVAFALEVIGKRTDAINRVVP
EVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDL
LERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccctggaccatgtcaccaagcagtacaaatcgtcggcgcgtccggcgttggat
gacatcaacgtcaagatcgacaagggtgagttcgtcttcctgatcggcccgtcgggttcg
ggcaagtcaaccttcatgcggctgctgctggcagcggagacgccgaccagtggtgatgtc
cgggtctcgaagtttcatgtcaacaaactccgcggtcgccacgtaccgaagctgcgtcag
gtgatcggctgcgtcttccaggactttcggttgctgcagcagaagacggtgtacgacaac
gtcgccttcgcattggaggtcatcggcaaacgcaccgacgcgatcaaccgggtggtcccc
gaagtgctcgagacggtcggtctgtccggcaaggccaatcggctgccagacgagctgtcg
ggcggcgagcaacagcgcgttgcgatcgcccgcgcctttgtcaaccggccgctggtactg
ctggccgacgagcccaccggaaacctcgacccggagaccagtagggacatcatggactta
ttggagcggatcaaccgcaccggcacgacggtgctgatggccacgcacgaccaccacatc
gtcgactcgatgcgccaacgggtggttgagttgtccctgggcaggctggtacgcgacgaa
cagcgtggcgtctacgggatggatcgctaa

DBGET integrated database retrieval system