KEGG   Mycobacterium canettii CIPT 140060008: BN44_60627Help
Entry
BN44_60627        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_3_6 Oxidored_q3
Motif
Other DBs
NCBI-ProteinID: CCK53107
Position
complement(3514565..3514768)
Genome map
AA seq 67 aa AA seqDB search
MPGKEIDRVRATSALAVIRQHPVMVFFALSPVLAALGVMWWLAGAGWAIVAALVLVVVGG
AMIVLKR
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcaaggaaatcgatcgagtccgggcgaccagtgccctcgcagtgattaggcag
cacccggtaatggtgttcttcgcgctgtcgccggtactcgccgcattaggtgtcatgtgg
tggctagccggtgctggatgggctatcgtcgcggccctggtgctggtggtcgtcggcgga
gccatgatcgtcctcaaacgctga

DBGET integrated database retrieval system