KEGG   Mycobacterium canettii CIPT 140060008: BN44_60629Help
Entry
BN44_60629        CDS       T02419                                 

Gene name
moaB
Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase MoaB1 (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (pterin-4-a-carbinolamine dehydratase) (phenylalanine hydroxylase-stimulating protein) (PHS) (pterin carbinolamine dehydratase) (PCD)
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00790  Folate biosynthesis
mcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN44_60629 (moaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcq04147]
    BN44_60629 (moaB)
Enzymes [BR:mcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BN44_60629 (moaB)
Exosome [BR:mcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN44_60629 (moaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: CCK53109
Position
3516372..3516767
Genome map
AA seq 131 aa AA seqDB search
MTVSTPEQHEQRASHDASEGKHNVCQGRLAALADAAVSEKLGALPGWQLLDMRLSRAFQC
TNFDQSIDFMNRVASIANDINHHPDIAVLDKRSVRVTAWTRKLGYLTDIDFDLAASVEAM
YATEFADRPAR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcagcacccctgagcaacacgagcaacgagcatcccacgatgcatccgaggga
aagcacaacgtatgtcaggggaggctggccgcacttgccgacgcggccgtgtcagagaaa
ctcggagcactacctggctggcagcttctcgacatgcgactcagccgcgcttttcagtgc
acaaatttcgaccaatccattgacttcatgaatagggtcgcatcaatagcaaacgatatc
aatcaccatcccgatatcgctgtactggacaagcgttcggtgcgcgtgacggcgtggacg
cgcaagctgggctatctgaccgacatcgacttcgatcttgcggcgtccgtcgaggcgatg
tatgcgacagaattcgctgacaggccagcacgatga

DBGET integrated database retrieval system