KEGG   Mycobacterium canettii CIPT 140060008: BN44_60631Help
Entry
BN44_60631        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: CCK53111
Position
3517305..3518339
Genome map
AA seq 344 aa AA seqDB search
MLKNAVLLACRAPSVHNSQPWRWVAESGSEHTTVHLFVNRHRTVPATDHSGRQAIISCGA
VLDHLRIAMTAAHWQANITRFPQPNQPDQLATVEFSPIDHVTAGQRNRAQAILQRRTDRL
PFDSPMYWHLFEPALRDAVDKDVAMLDVVSDDQRTRLVVASQLSEVLRRDDPYYHAELEW
WTSPFVLAHGVPPDTLASDAERLRVDLGRDFPVRSYQNRRAELADDRSKVLVLSTPSDTR
ADALRCGEVLSTILLECTMAGMATCTLTHLIESSDSRDIVRGLTRQRGEPQALIRVGIAP
PLAAVPAPTPRRPLDSVLQIRQTPEKGRNASDRNARETGWFSPP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaagaacgcagtcttgctggcatgccgggcgccgtcggtgcacaacagccagccc
tggcgttgggtggccgaaagcggctccgagcacactactgtgcacctgttcgtcaaccgc
caccgaacggtgccggccaccgaccattccggccggcaagcgatcatcagttgcggtgcc
gtactcgatcaccttcgcatcgccatgacggccgcgcactggcaggcgaatatcactcgc
tttccccagccgaaccaacctgaccagttggccaccgtcgaattcagtcccatcgatcac
gtcacggcgggacagcgaaaccgcgcccaggcgattctgcagcgccgaaccgatcggctt
ccgtttgacagcccgatgtactggcacctgtttgagcccgcgctgcgcgacgccgtcgac
aaagacgttgcgatgcttgatgtggtatccgacgaccagcgaacacgactggtggtagcg
tcacaactcagcgaagtcctgcggcgggacgatccgtactatcacgccgaactcgaatgg
tggacttcaccgttcgtgctggcccatggtgtgccgccggatacgctggcatcagacgcc
gaacgcttgcgagttgacctgggccgtgacttcccggtccggagctaccagaatcgccgt
gccgagctagctgatgaccgatcgaaagtccttgtgctgtcgacccctagcgacacgcga
gccgacgcactgaggtgtggcgaagtgctgtcgaccatcctactcgagtgcaccatggcc
ggcatggctacctgcacgttgacccatctgatcgaatccagtgacagtcgtgacatcgtg
cggggcctgacgaggcagcgaggcgagccgcaagccttgatccgggtagggatagccccg
ccgttggcagcagttcccgcccccacaccacggcggccgctggacagcgtcttgcagatt
cgccagacgcccgagaaagggcgtaatgcctcagatagaaatgcccgtgaaacgggttgg
ttcagcccgccttga

DBGET integrated database retrieval system