KEGG   Mycobacterium canettii CIPT 140060008: BN44_60634Help
Entry
BN44_60634        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridox_ox_2
Motif
Other DBs
NCBI-ProteinID: CCK53114
Position
3519818..3520150
Genome map
AA seq 110 aa AA seqDB search
MMQGRTVLFRTAEGAKLFSAVAKCAVAFEADDHNVAEGWSVIVKVRAQVLTTDAEVREAE
RAQLLPWTATLKRHCVRVIPWEITGRHFRFGPEPDRSQTFACEASSHNQR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcaaggccgcaccgtgctgtttcgtaccgcggagggcgccaaattattttcagcc
gtcgcgaagtgcgcggtggctttcgaggcggacgaccacaacgttgccgagggctggagc
gtgatcgtcaaggttcgcgcccaggtgctgacgaccgacgcggaggtccgcgaagccgaa
cgcgcccagttactaccgtggaccgcgacgctgaaacgtcactgtgtgcgggtgatcccg
tgggagatcaccggccgccacttcaggttcggtccggaaccggaccgcagccagaccttt
gcctgcgaggcctcgtcacacaaccagcgatag

DBGET integrated database retrieval system