KEGG   Mycobacterium canettii CIPT 140060008: BN44_60636Help
Entry
BN44_60636        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: CCK53116
Position
3521709..3522707
Genome map
AA seq 332 aa AA seqDB search
MNTHFPDAETVRTVLTLAVRAPSIHNTQPWRWRVCPTSLELFSRPDMQLRSTDPDGRELI
LSCGVALHHCVVALASLGWQAKVNRFPDPKDRCHLATIGVQPLVPDQADVALAAAIPRRR
TDRRAYSCWPVPGGDIALMAARAARGGVMLRQVSALDRMKAIVAQAVLDHVTDEEYLREL
TIWSGRYGSVAGVPARNEPPSDPSAPIPGRLFAGPGLSQPSDVLPADDGAAILALGTETD
DRLARLRAGEAASIVLLTATAMGLACCPITEPLEIAKTRDAVRAEVFGAGGYPQMLLRVG
WAPINADPLPPTPRRELSQVVEWPEELLRQRC
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccatttcccggacgccgaaaccgtgcgaacggttctcaccctggccgtccgg
gccccctccatccacaacacgcagccgtggcggtggcgggtatgcccgacgagtctggag
ctgttctctagacccgatatgcagctgcgtagcaccgatccggacgggcgtgagttgatc
ctcagctgtggtgtggcattgcaccactgcgtcgtcgctttggcgtcgctgggctggcag
gccaaggtaaaccgtttccccgatcccaaggaccgctgccatctggccaccatcggggta
caaccgcttgttcccgatcaggccgatgtcgccttggcggcggccataccgcggcgacgc
accgatcggcgcgcctacagttgctggccggtgccaggaggtgacatcgcgttgatggcc
gcaagagcagcccgtggcggggtcatgctgcggcaggtcagtgccctagaccgaatgaaa
gccattgtggcgcaggctgtcttggaccacgtgaccgacgaggaatatctgcgcgagctc
accatttggagtgggcgctacggttcagtggccggggttcccgcccgcaacgagccgcca
tcagaccccagtgccccgatccccggtcgcctgttcgccgggcccggtctgtctcagccg
tccgacgtcttacccgctgacgacggcgccgcgatcctggcactaggcaccgagacagac
gaccggttggcccggctgcgcgccggcgaggccgccagcatcgtcttgttgaccgcgacg
gcaatggggctggcgtgctgcccgatcaccgaaccgctggagatcgccaagacccgcgac
gcggtccgtgccgaggtgttcggcgccggcggctacccccagatgctgctgcgagtgggt
tgggcaccgatcaatgccgacccgttgccaccgacgccacggcgcgaactgtcccaggtc
gttgagtggccggaagagctactgcgacaacggtgctga

DBGET integrated database retrieval system