KEGG   Mycobacterium canettii CIPT 140060008: BN44_60642Help
Entry
BN44_60642        CDS       T02419                                 

Gene name
PPE
Definition
(GenBank) Conserved protein of unknown function, PPE family protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPE PE_PPE_C
Motif
Other DBs
NCBI-ProteinID: CCK53121
Position
3528289..3529431
Genome map
AA seq 380 aa AA seqDB search
MDFALLPPEVNSARMYTGPGAGSLWAAAGGWDSLAAELATTAEAYGSVLSGLAALHWRGP
AAESMAVTAAAYIGWLYTTAEKTQQTAIQARAAALAFEQAYAMTLPPPLVAANRIQLLAL
IATNFFGQNTAAIAATEAQYAEMWAQDAAAMYGYATASAAAALLTPFSPPRQTTNPAGLT
AQAAAVSQATDPLSLLIETVTQALQALTIPSFIPEDFTFLDAIFAGYATVGVTQDVESFV
AGTIGAESNLGLLNVGDENPAEVTPGDFGIGELVSATSPGGGVSASGAGGAASVGNTVLA
SVGRANSIGQLSVPPSWAAPSTRPVSALSPAGLTTLPGTDVAEHGMPGVPGVPVAAGRAS
GVLPRYGVRLTVMAHPPAAG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgcactgttaccaccggaagtcaactccgcccggatgtacaccggccctggg
gcaggatcgctgtgggctgccgcgggcggctgggattcgctggccgccgagttggccacc
acagccgaggcatatggatcggtgctgtccggactggccgccttgcattggcgtggaccg
gcagcggaatcgatggcggtgacggccgctgcctatatcggttggctgtacacgaccgcc
gaaaagacacagcaaacagcgatccaagccagggcggcagcgctggccttcgagcaagca
tacgcaatgaccctgccgccaccgctggtagcggccaaccggatacagctgctagcactg
atcgcgacgaacttcttcggccagaacactgcggcgatcgcggccaccgaggcacagtac
gccgagatgtgggcccaggacgccgccgcgatgtacggttacgccaccgcctcagcggct
gcggccctgctgacaccgttctccccgccgcggcagaccaccaacccggccggcctgacc
gctcaggccgccgcggtcagccaggccaccgacccactgtcgctgctgattgagacggtg
acccaagcgctgcaagcgctgacgattccgagcttcatccctgaggacttcaccttcctt
gacgccatattcgctggatatgccacggtaggtgtgacgcaggatgtcgagtcctttgtt
gccgggaccatcggggccgagagcaacctaggccttttgaacgtcggcgacgagaatccc
gcggaggtgacaccgggcgactttgggatcggtgagttggtttccgcgaccagtcccggc
ggtggggtgtctgcgtcgggtgccggcggtgcggcgagcgtcggcaacacggtgctcgcg
agtgtcggccgggcaaactcgattgggcaactatcggtcccaccgagctgggccgcgccc
tcgacgcgccctgtctcggcattgtcgcccgccggcctgaccacactcccggggaccgac
gtggccgagcacgggatgccaggtgtaccgggggtgccagtggcagcagggcgagcctcc
ggcgtcctacctcgatacggggttcggctcacggtgatggcccacccacccgcggcaggg
taa

DBGET integrated database retrieval system