KEGG   Mycobacterium canettii CIPT 140060008: BN44_60643Help
Entry
BN44_60643        CDS       T02419                                 

Gene name
PPE
Definition
(GenBank) Conserved protein of unknown function, PPE family protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCK53122
Position
complement(3529440..3529772)
Genome map
AA seq 110 aa AA seqDB search
MGWEFGVLLILIAVLAVFLAPRLIPRGPRGDLASGTLLVTGVSPRPDAGGQQYVTIAGII
TGPTVNEYAVYQRMAVDVDQWPTVGQILPVVYSPKNPDNWTFTPNGPPVG
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtgggatgggagtttggcgtgctactcatactgatcgcggtcctagcggtatttcttgct
ccgcggcttatcccgcgcggcccgcggggagatctggccagcggcacgctcctggtgacc
ggagtcagcccgcgaccggacgcaggcggccagcagtatgtcaccatcgccgggatcatc
actgggcccacggtcaatgagtacgccgtgtatcagcgcatggccgtcgacgtcgaccag
tggccgaccgtcggtcaaatacttccggtggtgtactcgccgaagaatcctgacaattgg
acgtttacgcccaacgggccgcctgtcggttag

DBGET integrated database retrieval system