KEGG   Mycobacterium canettii CIPT 140060008: BN44_60649Help
Entry
BN44_60649        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspG
Motif
Other DBs
NCBI-ProteinID: CCK53128
Position
complement(3535614..3536042)
Genome map
AA seq 142 aa AA seqDB search
MTEQEMTEQWLEGCAVQRIMFRDGLVLNFDDYNELVISVPLQLTLPAIETSPAEVVAIDP
NDPADHERPLFDFAGATCTAFAWYDTGDLHLEFSDGHQIDVHPDDRVTAWELYGKYHGYA
ACLAPGKLRVVRHDVADANGDQ
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaggaaatgaccgagcagtggttagagggctgtgcggttcagcggattatg
ttccgcgacggtctggtgctgaacttcgacgattacaacgagctggtcatctcggtacca
ctacagctgactctgccggccatcgaaacctcgcccgcagaagtggtcgccatcgaccca
aacgacccagccgaccacgagcgtccgctcttcgatttcgccggggcaacctgcacagct
ttcgcctggtatgacaccggagatctccatcttgagttctccgacggtcatcagatcgac
gtgcaccccgatgatcgcgtcaccgcatgggaactgtatggcaaataccacggatacgcc
gcgtgcctggcgccaggcaagctgcgagttgtgcggcatgacgtagccgacgccaacggc
gaccagtga

DBGET integrated database retrieval system