KEGG   Mycobacterium canettii CIPT 140060008: BN44_60651Help
Entry
BN44_60651        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function, PPE family protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPE
Motif
Other DBs
NCBI-ProteinID: CCK53130
Position
complement(3536584..3537813)
Genome map
AA seq 409 aa AA seqDB search
MSFVVLPPEINSLRMFIGAGTAPMLAAAAAWDGLAEELGTAAQSFASVTAGLAGQAWQGP
AALAMAAAAAPYAGWLTAAAAQSAGAAGQARAVASIFEAAQAATVLPAAVAANRDAFVQL
VMTNLFGQNAPLIAAAEGVYDEMWAADVAAMSGYYSGASAIAAQVVPWASLLQRFPGLGA
GATGATGGESVGTGATGGESVGTGGGESVGTGGATASGGGVGYVGGGVASAGLAAGDPAH
GSVGQGNFGGGDVGAGDVVASSATSAHAGVVSPGFIGAPLALAALGQMARGGTNSAPGPA
TESARAPEPAASAPPEAVVEVPELEVPAMGVLPTVDPKVAAKAAPLSTTRVGQSAGSGIP
ESTLRTAQGQQASETSAAEETAPSLRPEAAAGQLRPRVRQDPKIQMRGG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcgtcgtgctgccgccggagatcaattccttgcgaatgttcatcggtgcaggc
actgcgccgatgctggcggcggcggcggcctgggacgggcttgccgaagagttggggacc
gcggcgcaatcatttgcgtcggtcacggccgggctggcgggtcaggcgtggcagggtccg
gcagccttggcgatggcggcagcggcggctccctacgcggggtggttgaccgcggcagcg
gctcagtcggccggggcggcgggacaggcgcgcgcagtggccagcatcttcgaggcggcg
caggcggcgacggtgcttccggcggcggtggccgccaaccgcgacgcattcgtgcagctg
gtgatgacgaatttgttcgggcagaacgcgccgttgattgctgccgccgagggtgtgtac
gacgagatgtgggccgcggatgtggccgccatgtcggggtactactccggggcatcggcg
attgccgcgcaagtggtgccgtgggcgagtttgctgcagcgatttccgggtttgggtgcc
ggcgccaccggcgctactggcggtgagagcgtcggcaccggcgctactggcggtgagagc
gtcggcaccggcggcggtgagagcgtcggcaccggaggtgcaaccgctagcggcgggggc
gtcggctacgtcggaggcggcgtggctagcgccgggttagcggccggtgatccggcccat
ggcagtgtaggccaagggaatttcggcggtggcgatgttggcgccggagacgtcgtcgcg
tcgagcgctaccagtgcccatgccggcgttgtgagccccggcttcatcggtgccccgctc
gcgctcgccgctctgggtcagatggcacgtggcggcactaactctgccccgggacctgcc
accgagtcagctcgagcgccagagccggcggcttccgcgccaccggaagccgttgtggaa
gttccagaacttgaagttccagcaatgggggtgctgccaactgtggatccgaaagttgcg
gccaaggccgctccgctgtcgacaacgcgggtaggccaatccgcgggttctggaattccg
gaatcgacactacgcaccgcgcaaggtcagcaggcttcagagacttcagcggcggaggag
acagcgccgtcgttgcggccggaagcggcagcgggccaattacgacctcgggtaagacag
gacccgaagattcaaatgcggggcggctga

DBGET integrated database retrieval system