KEGG   Mycobacterium canettii CIPT 140060008: BN44_60652Help
Entry
BN44_60652        CDS       T02419                                 

Gene name
nuoA
Definition
(GenBank) Putative NADH dehydrogenase i (chain A) NuoA (NADH-ubiquinone oxidoreductase chain A)
  KO
K00330  NADH-quinone oxidoreductase subunit A [EC:1.6.5.3]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00190  Oxidative phosphorylation
mcq01100  Metabolic pathways
Module
mcq_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN44_60652 (nuoA)
Enzymes [BR:mcq01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     BN44_60652 (nuoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q4 DUF2888
Motif
Other DBs
NCBI-ProteinID: CCK53131
Position
3538178..3538564
Genome map
AA seq 128 aa AA seqDB search
MNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGA
ASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVW
RRGGLTWD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgtctacatacccatcctggtactggcggcgctggccgccgccttcgccgtggtg
tcggtggtgatcgcgagcctggtcggcccgtcgcggttcaaccggtcaaagcaggccgcc
tacgaatgcgggatcgagcccgctagcactggagccagaacctccattggccccggcgcg
gcgagcgggcagcggttccccatcaagtactacctgaccgcgatgttgttcatcgtcttc
gacatcgaaattgtgttcctctacccgtgggcggtcagctacgactcgctgggcacgttc
gcgctggtcgagatggcgatattcatgctcacggtgttcgtggcctacgcgtatgtgtgg
cgccgcgggggcctgacgtgggattga

DBGET integrated database retrieval system