KEGG   Mycobacterium canettii CIPT 140060008: BN44_60653Help
Entry
BN44_60653        CDS       T02419                                 

Gene name
nuoB
Definition
(GenBank) Putative NadH dehydrogenase I (chain b) NuoB (NADH-ubiquinone oxidoreductase chain b)
  KO
K00331  NADH-quinone oxidoreductase subunit B [EC:7.1.1.2]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00190  Oxidative phosphorylation
mcq01100  Metabolic pathways
Module
mcq_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN44_60653 (nuoB)
Enzymes [BR:mcq01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BN44_60653 (nuoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: CCK53132
Position
3538573..3539127
Genome map
AA seq 184 aa AA seqDB search
MGLEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMATAGPRFDIARFGMERF
SATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAMGVCASSGGMFNNYAIVQGVD
HVVPVDIYLPGCPPRPEMLLHAILKLHEKIQQMPLGINRERAIAEAEEAALLARPTIEMR
GLLR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgggactggaagaacagctgcccggcgggatcctgctgtcgaccgtcgagaaggtggcg
ggctatgtccgcaaaaactccctgtggccggcaacattcggattggcgtgctgtgcgatc
gagatgatggcgaccgcgggaccaaggtttgacattgcgcggttcgggatggaacggttc
tcggccacgccgcggcaggcagatctgatgatcgtggcgggccgggtcagccagaagatg
gcgccggtactgcgccagatctatgaccagatggcggagccgaaatgggttctggccatg
ggtgtgtgcgcctcgtcaggtgggatgttcaacaactatgcgatcgtgcagggcgtggat
catgttgttccggtcgacatctacctacccggctgcccgccgcgcccggagatgctgctg
cacgcaatcctgaagctgcacgaaaagattcagcagatgccattaggtatcaaccgggaa
cgcgctatcgccgaggccgaagaggcggcgttgttggcccggcccaccatcgagatgcgc
ggactgctgcgatga

DBGET integrated database retrieval system