KEGG   Moraxella catarrhalis 25240: DR90_1448Help
Entry
DR90_1448         CDS       T03217                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcs  Moraxella catarrhalis 25240
Pathway
mcs00071  Fatty acid degradation
mcs00072  Synthesis and degradation of ketone bodies
mcs00280  Valine, leucine and isoleucine degradation
mcs00310  Lysine degradation
mcs00362  Benzoate degradation
mcs00380  Tryptophan metabolism
mcs00620  Pyruvate metabolism
mcs00630  Glyoxylate and dicarboxylate metabolism
mcs00640  Propanoate metabolism
mcs00650  Butanoate metabolism
mcs00900  Terpenoid backbone biosynthesis
mcs01100  Metabolic pathways
mcs01110  Biosynthesis of secondary metabolites
mcs01120  Microbial metabolism in diverse environments
mcs01130  Biosynthesis of antibiotics
mcs01200  Carbon metabolism
mcs01212  Fatty acid metabolism
mcs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR90_1448
   00630 Glyoxylate and dicarboxylate metabolism
    DR90_1448
   00640 Propanoate metabolism
    DR90_1448
   00650 Butanoate metabolism
    DR90_1448
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DR90_1448
   00072 Synthesis and degradation of ketone bodies
    DR90_1448
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR90_1448
   00310 Lysine degradation
    DR90_1448
   00380 Tryptophan metabolism
    DR90_1448
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR90_1448
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR90_1448
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DR90_1448
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcs04147]
    DR90_1448
Enzymes [BR:mcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR90_1448
Exosome [BR:mcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR90_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIK00429
Position
1556560..1557843
Genome map
AA seq 427 aa AA seqDB search
MSLNKVAILGGNRIPFARSNGVYADANNIDMLTAALDGLVARFDLADKQIGEVVAGTVLK
HSRDLNLTREAVLNTQLPATTPAYDISQACGTGLQAAFAVANKIALGLIDNGIAGGTDTT
SDAPIALGDGLRKPLLRLGNAKTAKQKLSALSTINPKDLLAFPQNGEPRTRLSMGEHQAI
TALEWNISRTDQDELAYNSHQNLAQAYESGFFDDLITPYKGLTKDNNLRPDTTLEKLASL
KPAFGKKNANPTMTAGNSTPLTDGASVVLLSSDAWAKEHGHEPLAYITHQQTAAVDFIGK
EGLTEGLLMAPAYAVPKMLKRAGLTLQDFDFYEIHEAFASQVLSTLAAWEDETFCKTRLG
LDAPLGSIDRSKLNVNGSSLAAGHPFAATGGRILATAAKLLAQKGSGHALVSICAAGGQG
VVCILER
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaataaagttgccatcttaggcggtaatcgcattccttttgcacgtagtaat
ggcgtatatgctgatgccaacaacattgatatgctcactgcagcattagatggattggtt
gctcgttttgatttggcggataaacaaattggtgaagttgtggcaggtactgtcttaaaa
cacagtcgtgacctaaacttaacccgtgaggcagtgcttaacacccaattacctgcaacg
acgcctgcttatgatatctcgcaagcctgtggtactggactacaagcagcttttgctgtg
gcaaataaaattgcactaggccttattgataatggtattgcaggcggtacagacacaacc
tctgatgcaccgattgcattgggtgatggtctgcgtaagccgcttttgcgtttaggcaat
gccaaaacagccaagcaaaaactgtccgcacttagcaccatcaaccccaaagatttatta
gccttcccccaaaatggtgaaccacgcactcgcctttcaatgggcgaacaccaagccatc
accgcacttgagtggaatatcagtcgcaccgatcaagatgaacttgcctataacagccat
caaaacttggctcaggcgtatgaatcaggattttttgatgacttaatcacaccttataaa
ggcttgaccaaagataataatttgcgtcctgataccacacttgaaaaattagccagtcta
aaacctgcctttggcaaaaaaaatgccaatccaaccatgaccgcaggtaactcaacgcca
ctcacagatggtgcttctgtggtgctactgtctagtgacgcatgggcaaaagagcatggg
catgagccacttgcttatatcactcaccagcagacagcagcggttgattttattggtaaa
gaaggtttaaccgaaggtcttttaatggcacctgcttatgccgtgcctaagatgctcaag
cgtgcaggtttgaccttgcaagattttgatttttatgaaattcatgaagcttttgcctct
caggtactttctactttggcagcttgggaagatgagactttctgtaaaactcgcttggga
ctagatgcaccactaggtagcatcgatcgcagtaagcttaatgtcaatggctcaagctta
gcagcaggtcacccctttgcagcaacaggtggacgaattttggcgacagcagccaaacta
ttggctcaaaaaggctcaggccatgcattggtttctatttgtgctgctggtggtcagggt
gttgtgtgtatcttagagagataa

DBGET integrated database retrieval system