KEGG   Moraxella catarrhalis 25240: DR90_328Help
Entry
DR90_328          CDS       T03217                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mcs  Moraxella catarrhalis 25240
Pathway
mcs00620  Pyruvate metabolism
mcs00630  Glyoxylate and dicarboxylate metabolism
mcs01100  Metabolic pathways
mcs01110  Biosynthesis of secondary metabolites
mcs01120  Microbial metabolism in diverse environments
mcs01200  Carbon metabolism
Module
mcs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR90_328 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    DR90_328 (glcB)
Enzymes [BR:mcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DR90_328 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase OB_Dis3
Motif
Other DBs
NCBI-ProteinID: AIK00634
Position
361824..363986
Genome map
AA seq 720 aa AA seqDB search
MTTQRIIKGSLAIDKILFDFIENEALPIAKLDSDTYWRNFEQVVLELTPKNKALLAHREK
LQAKIDDWHKNHVYELGAYKQFLSEIGYLEPEVADFTITTENVDEEIATMAGPQLVVPVR
NARYCLNAANARWGSLYDALYGFDIIAETDGAEKGKGYNPVRGAKVIAFAKNFLDETFPL
VDGSHADVISYAIKDGQLSANMGKSWSTLTENKVVGYNGVPDNPSEIILKNNGLHVIIQI
DPHSIIGKDDKAGVKDILLESAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGDLSETL
EKNGKTITRTLNADRTYTDLNGNTQTLHGRSLMLLRNVGHLMTNPAILVGGEEIFEGMMD
ALITPMLCAIDIRGENTLRNSRTGSMYIVKPKMHGSQEVAFAAELFSCAEKAIGLPKNSL
KMGIMDEERRTSANLKNCIAQAYERTIFINTGFMDRTGDEIHTAMHAGAFVRKGEIKEQI
WFHAYEKRNVLIGLNAGLRGKAQIGKGMWPKPDELADMYRTKIEHPQAGASCAWVPSPSG
AVIHAIHYHKCNVTKRQEELARLAIPSLDDLLTIALATDTNWTAEQKRRELENNCQGILG
YVVRWVDLGVGCSKVPDINDVGLMEDRATLRISSQHVANWLVHGIVTADEVWDALRRMAK
VVDEQNASDPAYRPMSSDFDNNIAFQTAAELIFKGATEPSGYTEPLLHRARLKLKGYQGD
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaacgcatcatcaaaggctcgcttgccattgacaagattttatttgatttt
attgaaaatgaagccttacctatcgccaaacttgacagtgatacttattggagaaatttt
gagcaagttgtgcttgaattgaccccaaaaaataaagccttgcttgcccatcgtgagaaa
ttgcaagccaagattgacgattggcacaaaaatcatgtttatgagctgggtgcgtataag
caatttttaagcgaaattggctatcttgaacctgaggttgcagattttaccatcaccacc
gaaaatgtcgatgaggagattgccaccatggcagggccccagcttgtcgtgcctgtgcgt
aatgcccgctattgcctaaatgccgccaatgcccgttgggggtcgctttatgatgcgtta
tatggttttgatatcatcgcagaaacggacggtgctgaaaaaggtaagggctataatcct
gtgcgtggggcaaaggtcatcgcatttgccaaaaattttcttgatgaaactttcccgctt
gtggacggctcacacgctgatgtcatatcttatgccataaaagacggtcaattatctgcc
aatatgggcaaatcttggagcactttaacagaaaataaagtggtaggctataatggcgtg
cctgacaatccgagcgaaatcatattaaaaaacaacggcttacatgtcatcatccagatt
gacccacacagtatcattggcaaagatgacaaagcaggggttaaggatatactgctagaa
tctgccgttaccaccattcaagatttggaggactctgtggcggcggtagatgccgaagaa
aaagtggagggctatcgcaactggctgggtcttatgaaaggtgatttgtctgagacctta
gaaaaaaatggcaaaaccatcacccgtacgctaaatgctgaccgcacttataccgaccta
aatggcaatacccaaactctgcatgggcgttcactcatgctgcttcgcaatgtggggcat
ttgatgacaaatcctgccatcttggtgggtggcgaggagatttttgaggggatgatggat
gcacttatcacgcccatgctctgtgccattgacattcgtggtgaaaataccttgcgtaac
tctcgcacaggttcaatgtatattgtcaagccaaaaatgcacggttcacaagaggtggcg
tttgctgccgagctgttctcttgtgccgaaaaagccattggcttgcccaaaaatagccta
aaaatgggcatcatggatgaagagcgtagaacctctgccaacctaaaaaactgtatcgcc
caagcttatgagcggacgatttttattaacacaggctttatggacagaacaggcgatgag
attcataccgccatgcatgcaggggcatttgtgcgtaagggtgagattaaagagcaaatc
tggtttcatgcctatgaaaaacgcaatgtcttaatcggtcttaatgcaggactgcgtggt
aaggctcaaattggtaaaggcatgtggccaaagcctgatgagcttgccgatatgtatcgc
accaaaattgagcatccacaagctggggcaagctgtgcatgggtgccatcgccaagcggg
gcggtgattcatgccattcattatcacaaatgcaatgttacaaaacgccaagaagaattg
gcacgccttgccataccaagtcttgatgatttattgaccattgctcttgccaccgatacc
aattggacagcagaacaaaaacgccgtgaacttgaaaacaactgccaaggcatcttaggt
tatgtggtgcgttgggttgatttgggcgtgggttgctccaaagtgcctgatatcaatgat
gtggggctgatggaagaccgtgccactttgcgtatctcctctcagcatgtcgccaactgg
ctggttcatggtatcgtaaccgccgatgaggtgtgggatgccctaagacgcatggcaaaa
gttgttgatgaacaaaacgcatccgaccccgcctatcgcccaatgtcatctgattttgat
aacaacattgcctttcaaaccgccgccgagcttatctttaaaggagcgaccgaaccatct
ggctataccgagccgctattacatagggcaagattaaaactaaaaggttatcaaggcgac
tga

DBGET integrated database retrieval system