KEGG   Moraxella catarrhalis BBH18: MCR_0459Help
Entry
MCR_0459          CDS       T01224                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase FadI
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
mct00071  Fatty acid degradation
mct00072  Synthesis and degradation of ketone bodies
mct00280  Valine, leucine and isoleucine degradation
mct00310  Lysine degradation
mct00362  Benzoate degradation
mct00380  Tryptophan metabolism
mct00620  Pyruvate metabolism
mct00630  Glyoxylate and dicarboxylate metabolism
mct00640  Propanoate metabolism
mct00650  Butanoate metabolism
mct00900  Terpenoid backbone biosynthesis
mct01100  Metabolic pathways
mct01110  Biosynthesis of secondary metabolites
mct01120  Microbial metabolism in diverse environments
mct01130  Biosynthesis of antibiotics
mct01200  Carbon metabolism
mct01212  Fatty acid metabolism
mct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCR_0459
   00630 Glyoxylate and dicarboxylate metabolism
    MCR_0459
   00640 Propanoate metabolism
    MCR_0459
   00650 Butanoate metabolism
    MCR_0459
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCR_0459
   00072 Synthesis and degradation of ketone bodies
    MCR_0459
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCR_0459
   00310 Lysine degradation
    MCR_0459
   00380 Tryptophan metabolism
    MCR_0459
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCR_0459
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCR_0459
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MCR_0459
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mct04147]
    MCR_0459
Enzymes [BR:mct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCR_0459
Exosome [BR:mct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCR_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADG60731
UniProt: D5VAM8
Position
complement(475837..477120)
Genome map
AA seq 427 aa AA seqDB search
MSLNKVAILGGNRIPFARSNGVYADANNIDMLTAALDGLVARFDLADKQIGEVVAGTVLK
HSRDLNLTREAVLNTQLPATTPAYDISQACGTGLQAAFAVANKIALGLIDNGIAGGTDTT
SDAPIALGDGLRKPLLRLGNAKTAKQKLSALSTINPKDLLAFPQNGEPRTRLSMGEHQAI
TALEWNISRTDQDELAYNSHQNLAQAYESGFFDDLITPYKGLTKDNNLRPDTTLEKLASL
KPAFGKKNVNPTMTAGNSTPLTDGASVVLLSSDAWAKEHGHEPLAYITHQQTAAVDFIGK
EGLTEGLLMAPAYAVPKMLKRAGLTLQDFDFYEIHEAFASQVLSTLAAWEDETFCKTRLG
LDAPLGSIDRSKLNVNGSSLAAGHPFAATGGRILATAAKLLAQKGSGRALVSICAAGGQG
VVCILER
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaataaagttgccatcttaggcggtaatcgcattccttttgcgcgtagtaat
ggcgtatatgctgatgccaacaacattgatatgctcactgcagcattagatggattggtt
gctcgttttgatttggcggataaacaaattggtgaagttgtggcaggtactgtcttaaaa
cacagtcgtgacctaaacttaacccgtgaggcagtgcttaacacccaattacctgcaacg
acgcctgcttatgatatctcgcaagcctgtggtactggactacaagcagcttttgctgtg
gcaaataaaattgcgctaggccttattgataatggtattgcaggcggtacagacacaacc
tctgatgcaccgattgcattgggtgatggtctgcgtaagccgcttttgcgtttaggcaat
gccaaaacagccaagcaaaaactgtctgcacttagcaccatcaaccccaaagatttatta
gccttcccccaaaatggtgaaccacgcactcgcctttcaatgggcgaacaccaagccatc
accgcacttgagtggaatatcagtcgcaccgatcaagatgaacttgcctataacagccat
caaaacttggctcaggcgtatgaatcaggattttttgatgacttaattacaccttataaa
ggcttgaccaaagataataatttgcgtcctgataccacacttgaaaaattagccagtcta
aaacctgcctttggcaaaaaaaatgtcaatccaaccatgaccgcaggtaactcaacgcca
ctcacagatggtgcttctgtggtgctactgtctagtgacgcatgggcaaaagagcatggg
catgagccacttgcttatatcactcaccagcagacagcagcggttgattttattggtaaa
gaaggtttaaccgaaggtcttttaatggcacctgcttatgccgtgcctaagatgctcaag
cgtgcaggtttgaccttgcaagattttgatttttatgaaattcatgaagcttttgcctct
caggtactttctactttggcagcttgggaagatgagactttctgtaaaactcgcttggga
ctagatgcaccactcggcagcatcgatcgcagtaagcttaatgtcaatggctcaagctta
gcagcaggtcacccctttgcagcaacaggtggacgaattttggcgacagcagccaaacta
ttggctcaaaaaggctcaggccgtgcattggtttctatttgtgctgctggtggtcagggc
gttgtgtgtatcttggagagataa

DBGET integrated database retrieval system