KEGG   Moraxella catarrhalis BBH18: MCR_1621Help
Entry
MCR_1621          CDS       T01224                                 

Gene name
aceB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
mct00620  Pyruvate metabolism
mct00630  Glyoxylate and dicarboxylate metabolism
mct01100  Metabolic pathways
mct01110  Biosynthesis of secondary metabolites
mct01120  Microbial metabolism in diverse environments
mct01200  Carbon metabolism
Module
mct_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCR_1621 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MCR_1621 (aceB)
Enzymes [BR:mct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MCR_1621 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADG61878
UniProt: D5V8I9
Position
complement(1594617..1596779)
Genome map
AA seq 720 aa AA seqDB search
MTTQRIIKGSLAIDKILFDFIENEALPIAKLDSDTYWRNFEQVVLELTPKNKALLAHREK
LQAKIDDWHKNHVYELGAYKQFLSEIGYLEPEVADFTITTENVDEEIATMAGPQLVVPVR
NARYCLNAANARWGSLYDALYGFDIIAETDGAEKGKGYNPVRGAKVIAFAKNFLDETFPL
VDGSHADVISYAIKDGQLSANMGKSWSTLTENKVVGYNGVPDNPSEIILKNNGLHVIIQI
DPHSIIGKDDKAGVKDILLESAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGDLSETL
EKNGKTITRTLNADRTYTDLNGNTQTLHGRSLMLLRNVGHLMTNPAILVGGEEIFEGMMD
ALITPMLCAIDIRGENTLRNSRTGSMYIVKPKMHGSQEVAFAAELFSCAEKAIGLPKNSL
KMGIMDEERRTSANLKNCIAQAYERTIFINTGFMDRTGDEIHTAMHAGAFVRKGEIKEQI
WFHAYEKRNVLIGLNAGLRGKAQIGKGMWPKPDELADMYRTKIEHPQAGASCAWVPSPSG
AVIHAIHYHKCNVTKRQEELARLAIPSLDDLLTIALATDTNWTAEQKRRELENNCQGILG
YVVRWVDLGVGCSKVPDINDVGLMEDRATLRISSQHVANWLVHGIVTADEVWDALRRMAK
VVDEQNASDPAYRPMSSDFDNNIAFQTAAELIFKGATEPSGYTEPLLHRARLKLKGYQGD
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaacgcatcatcaaaggctcgcttgccattgacaagattttatttgatttt
attgaaaatgaagccttacctatcgccaaacttgacagtgatacttattggagaaatttt
gagcaagttgtgcttgaattgaccccaaaaaataaagccttgcttgcccatcgtgagaaa
ttgcaagccaagattgacgattggcacaaaaatcatgtttatgagctgggtgcgtataag
caatttttaagcgaaattggctatcttgaacctgaggttgcagattttaccatcaccacc
gaaaatgtcgatgaggagattgccaccatggcagggccccagcttgtcgtgcctgtgcgt
aatgcccgctattgcctaaatgccgccaatgcccgttgggggtcgctttatgatgcgtta
tatggttttgatatcatcgcagaaacggacggtgctgaaaaaggtaagggctataatcct
gtgcgtggggcaaaggtcatcgcatttgccaaaaattttcttgatgaaactttcccgctt
gtggacggctcacacgctgatgtcatatcttatgccataaaagacggtcaattatctgcc
aatatgggcaaatcttggagcactttaacagaaaataaagtggtaggctataatggcgtg
cctgacaatccgagcgaaatcatattaaaaaacaacggcttacatgtcatcatccagatt
gacccacacagtatcattggcaaagatgacaaagcaggggttaaggatatactgctagaa
tctgccgttaccaccattcaagatttggaggactctgtggcggcggtagatgccgaagaa
aaagtggagggctatcgcaactggctgggtcttatgaaaggtgatttgtctgagacctta
gaaaaaaatggcaaaaccatcacccgtacgctaaatgctgaccgcacttataccgaccta
aatggcaatacccaaactctgcatgggcgttcactcatgctgcttcgcaatgtggggcat
ttgatgacaaatcctgccatcttggtgggtggcgaggagatttttgaggggatgatggat
gcacttatcacgcccatgctctgtgccattgacattcgtggtgaaaataccttgcgtaac
tctcgcacaggttcaatgtatattgtcaagccaaaaatgcacggttcacaagaggtggcg
tttgctgccgagctgttctcttgtgccgaaaaagccattggcttgcccaaaaatagccta
aaaatgggcatcatggatgaagagcgtagaacctctgccaacctaaaaaactgtatcgcc
caagcttatgagcggacgatttttattaacacaggctttatggacagaacaggcgatgag
attcataccgccatgcatgcaggggcatttgtgcgtaagggtgagattaaagagcaaatc
tggtttcatgcctatgaaaaacgcaatgtcttaatcggtcttaatgcaggactgcgtggt
aaggctcaaattggtaaaggcatgtggccaaagcctgatgagcttgccgatatgtatcgc
accaaaattgagcatccacaagctggggcaagctgtgcatgggtgccatcgccaagcggg
gcggtgattcatgccattcattatcacaaatgcaatgttacaaaacgccaagaagaattg
gcacgccttgccataccaagtcttgatgatttattgaccattgctcttgccaccgatacc
aattggacagcagaacaaaaacgccgtgaacttgaaaacaactgccaaggcatcttaggt
tatgtggtgcgttgggttgatttgggcgtgggttgctccaaagtgcctgatatcaatgat
gtggggctgatggaagaccgtgccactttgcgtatctcctctcagcatgtcgccaactgg
ctggttcatggtatcgtaaccgccgatgaggtgtgggatgccctaagacgcatggcaaaa
gttgttgatgaacaaaacgcatccgaccccgcctatcgcccaatgtcatctgattttgat
aacaacattgcctttcaaaccgccgccgagcttatctttaaaggagcgaccgaaccatct
ggctataccgagccgctattacatagggcaagattaaaactaaaaggttatcaaggcgac
tga

DBGET integrated database retrieval system