KEGG   Moraxella catarrhalis BBH18: MCR_1622Help
Entry
MCR_1622          CDS       T01224                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
mct00630  Glyoxylate and dicarboxylate metabolism
mct01100  Metabolic pathways
mct01110  Biosynthesis of secondary metabolites
mct01120  Microbial metabolism in diverse environments
mct01200  Carbon metabolism
Module
mct_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MCR_1622 (aceA)
Enzymes [BR:mct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MCR_1622 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase RRP36 DUF3944
Motif
Other DBs
NCBI-ProteinID: ADG61879
UniProt: D5V8J0
Position
complement(1596937..1598535)
Genome map
AA seq 532 aa AA seqDB search
MTYQSALEHVRSVKAKLGNHWNAIRPEDAARMVVQNRFKTGLDIAKYTASIMRRDMAEYD
ADNSKYTQSLGCWHGFIAQQKMIANKKYFGTTSKRYIYLSGWMVAALRSEFGPLPDQSMH
EKTAVPKLIEEIYTFLRQADAKELNDLFRALQQAEQAGDEAKVKEIEAKIDNFETHVVPI
IADIDAGFGNEEATYLLTKQMIEAGACAIQIENQVSDAKQCGHQAGKVTVPHEDFLAKIN
AVRYAFLELGVDEGVIVARTDSEGADLTQKIPVSREAGDLASKYISYLQTTEIDISEAKE
DEILIKRNGKLHRPTRLPSGLYQFREGTQHERVVLDCVTSLQNGADMIWIETPTPDVAGI
ARFVNDIKKQVPDAKLVYNNSPSFNWTINFRQQAYDRWADEGRDLSGYDRDKLMDAQYDD
SELAYDADEKIRTFQADAAREAGVFHHLITLPTYHTAALSTHELAKGYFGDEGMLAYVAG
VQRKEIRDGIACVKHQAMAGSDIGDDHKEIFSGENALKAGDASKNTMNQFGG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacctaccaatcagccctagaacatgttcgctctgttaaagccaaattaggtaatcat
tggaacgccatccgcccagaagatgccgctcgtatggttgtccaaaaccgttttaaaaca
ggtcttgatatcgccaaatacaccgcaagcatcatgcgtcgtgatatggcagagtatgat
gctgataactcaaaatacacccaatcccttggctgttggcatggatttatcgcccagcaa
aagatgattgccaacaaaaaatactttggcactaccagcaaacgctacatctacctatca
ggctggatggttgctgcattgcgttctgaatttggtccattgcctgaccaatccatgcac
gaaaaaaccgccgtaccaaaactcattgaagagatttatacttttcttcgtcaagcagat
gccaaagagctaaatgatttattccgtgccttgcaacaagcagagcaagcaggcgatgag
gcaaaggtcaaagaaattgaagcgaaaattgacaactttgaaacccatgttgtgccaatc
atcgctgacattgatgcaggttttggtaacgaagaagcaacctatttattaaccaaacaa
atgattgaagcgggtgcttgtgccattcaaattgaaaatcaggtgtcagatgctaagcaa
tgtgggcatcaagcgggtaaagtgactgtaccacacgaagactttttggcaaaaattaac
gccgtgcgttatgcgttcttagagcttggcgtggatgagggcgtgattgtggcccgtacc
gactcagagggtgctgatttgacccaaaaaatcccagtcagccgtgaagcgggcgatttg
gcgagtaaatacatcagctatttacagaccaccgagattgacatcagtgaagccaaagaa
gatgaaattcttatcaagcgtaacggcaagctacaccgcccaactcgtctgccatcgggt
ctatatcaattccgtgaaggcacgcagcatgagcgtgtggtgctagattgtgtcacatcg
ctacaaaacggtgcggacatgatttggattgagaccccaaccccagatgtggcgggcatt
gcaagatttgtcaatgacatcaaaaaacaagtaccagatgccaaattggtgtacaacaat
tcaccatcgtttaactggacaatcaacttccgccaacaagcctatgaccgctgggcggat
gaaggtcgtgatttatcaggctatgaccgtgataagctcatggatgcccaatatgatgac
agtgagcttgcttatgatgctgatgaaaaaatccgtactttccaagcagatgctgcccgt
gaagctggcgtatttcaccatctcatcacattacccacttatcacactgccgctttatct
acccatgagcttgccaaaggctactttggcgatgagggcatgcttgcctatgtcgctggt
gtgcagcgtaaagagattcgtgatggtatcgcttgcgtgaaacaccaagccatggcaggc
tctgacattggcgatgaccacaaagagattttctcaggtgaaaacgccctaaaagcgggc
gatgcaagtaagaacaccatgaaccaatttggcggttaa

DBGET integrated database retrieval system