KEGG   Mobiluncus curtisii: HMPREF0573_10462Help
Entry
HMPREF0573_10462  CDS       T01257                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00900  Terpenoid backbone biosynthesis
mcu01100  Metabolic pathways
mcu01110  Biosynthesis of secondary metabolites
mcu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0573_10462 (ispE)
Enzymes [BR:mcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF0573_10462 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADI66781
UniProt: D6ZJ82
Position
complement(530324..531259)
Genome map
AA seq 311 aa AA seqDB search
MSGVRILENEPGRRLKVFAPGKVNLLLQVGQRPAGQPRHELLTVFQCLDLGEYLTVEPRD
AGETDMVHTVLAPGLTGPKNLDGPENLALKAVRTLRETGATVPFTSIKIEKNIPVAGGMA
GGSADAAGVLYAVNQLYELGFTSSDLQSLGAKLGADVPYGLTGGNALGLGFGDRMQSLPV
GTKCYWVLAVSPRGLSTPEVFKAFDRMVSHPQPLPSALSPDFLAALDGNPAELAGYLHND
LQTAALSIFPELSQIIVAAEQAGALKALVSGSGPTVAALCPDASSQKIVAARLEAHPLVA
CVFSATGPVCS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgtgaggattctcgagaatgaaccgggacggcgcctcaaagtgtttgcaccc
ggaaaagtgaacctgttgcttcaggtggggcagcgtcctgctgggcagccacgacacgag
ctactgacggtattccagtgcctggatctgggagaatatctgacggtagaaccccgtgat
gcaggcgaaacagatatggttcatactgtgctggctcccggattgactggaccaaagaac
ctggacggaccggaaaacctcgctctcaaagcggttcggaccttgcgtgaaactggtgcc
acagtgcccttcaccagcataaagattgagaaaaatattccggtggcaggtggtatggca
ggagggtcagccgatgccgccggggtgttatatgctgtgaaccagctttacgaactggga
ttcaccagcagcgatctgcagtctctgggggcgaaactgggcgcggacgtgccttacggt
ctaaccgggggaaacgctttggggcttgggttcggagacagaatgcagagtttaccggtc
ggtacaaaatgctactgggtcctggcggtttctcctcgtggtctgtccacgccggaagtt
tttaaagctttcgacaggatggtttcgcatccgcagcccctaccttccgcactttcgccc
gacttcctagcagctctggatgggaatcccgctgaactggctggataccttcacaacgat
ttgcagaccgcagccctaagcattttccccgagctatcccaaattatcgtcgcggcagag
caggcgggggctttgaaagctctcgtttccggctccggtccgaccgttgccgctttgtgc
ccagatgcgtcctcccaaaaaatagtggcggcgaggctggaggcgcatcctttggtagcg
tgtgtgttcagcgccaccggaccggtatgcagctga

DBGET integrated database retrieval system