KEGG   Mobiluncus curtisii: HMPREF0573_11605Help
Entry
HMPREF0573_11605  CDS       T01257                                 

Definition
(GenBank) Biotin-requiring enzyme
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00020  Citrate cycle (TCA cycle)
mcu00310  Lysine degradation
mcu01100  Metabolic pathways
mcu01110  Biosynthesis of secondary metabolites
mcu01120  Microbial metabolism in diverse environments
mcu01130  Biosynthesis of antibiotics
mcu01200  Carbon metabolism
Module
mcu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_11605
  Amino acid metabolism
   00310 Lysine degradation
    HMPREF0573_11605
Enzymes [BR:mcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HMPREF0573_11605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADI67924
UniProt: D6ZH16
Position
complement(1809280..1809495)
Genome map
AA seq 71 aa AA seqDB search
MPALGESVTEGTVTKWLKNVGDPVALDEPLLEVSTDKVDTEIPSPIAGTITQIVITEDET
VDVGTVLAYIG
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgccagccctgggtgagtccgtcaccgaaggcactgtcaccaaatggctgaaaaacgtc
ggcgaccctgtcgccttagacgaacctctcctggaagtctccaccgacaaagtcgacacc
gagattccctcccccattgctggcaccatcacccaaatcgtcatcactgaagacgaaacc
gtagacgtcggcaccgtcctcgcctacatcggttag

DBGET integrated database retrieval system