KEGG   Methanobacterium congolense: MCBB_1980Help
Entry
MCBB_1980         CDS       T04503                                 

Gene name
mtrA1
Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit A 1 {ECO:0000255|HAMAP-Rule:MF_01093}
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mcub  Methanobacterium congolense
Pathway
mcub00680  Methane metabolism
mcub01100  Metabolic pathways
mcub01120  Microbial metabolism in diverse environments
mcub01200  Carbon metabolism
Module
mcub_M00357  Methanogenesis, acetate => methane
mcub_M00567  Methanogenesis, CO2 => methane
mcub_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mcub00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MCBB_1980 (mtrA1)
Enzymes [BR:mcub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MCBB_1980 (mtrA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA MtrF
Motif
Other DBs
NCBI-ProteinID: SCG86528
UniProt: A0A1D3L4Q6
Position
I:complement(2058657..2059379)
Genome map
AA seq 240 aa AA seqDB search
MADKKSPAEGWPVVNGDYVVGDPESPVAAVTLASHIEDVPAEAGAAIAGPCKTENLGVEK
VIANIISNPNIRFLILCGAEVQGHITGQSIQALHENGVDPEKRSILGATGAIPYVENVPD
EGIERFQQQLELVDLIDVEDPASIQSKVKECIEKDPGAFEEEAMVIEISEEDGEEEEGEE
VKPVAPETALIDARIRNIQTQVKMIGANQRIFAGMYAGKVQGLVIGLAFILTLGTILLLK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaatcacccgcagaaggatggcctgttgtaaacggtgactacgtggtc
ggagacccagaaagccctgttgcagcagttacactggcttctcacattgaagatgtacca
gcggaagcaggagcagcaatagcaggaccatgcaaaaccgaaaacctcggagtcgagaag
gttatagctaacataatttccaacccgaacataaggttcctaatactctgtggagcagag
gtgcagggacacatcaccggtcagagtatacaggcgttacacgaaaatggtgttgaccca
gaaaaaagaagcatcttaggtgcaactggagctataccatacgttgaaaacgtaccagac
gaaggaatagaaaggttccagcagcagctggaattagtggacctcatagatgttgaggat
cctgcatctatccagtctaaagtaaaagagtgcatagaaaaagatcctggtgcctttgaa
gaagaagcaatggtcatagagatctcagaggaagacggtgaagaggaagaaggtgaagaa
gttaaaccagtagcacctgaaacagcattaatcgatgcaaggatacgcaacatacagaca
caggtcaaaatgatcggtgcaaatcagaggatctttgcaggtatgtacgctggaaaagtt
cagggacttgtaataggtttagcattcatcttaactcttggaaccatactactcttgaaa
taa

DBGET integrated database retrieval system