KEGG   Methanobacterium congolense: MCBB_1981Help
Entry
MCBB_1981         CDS       T04503                                 

Gene name
mtrB
Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit B
  KO
K00578  tetrahydromethanopterin S-methyltransferase subunit B [EC:2.1.1.86]
Organism
mcub  Methanobacterium congolense
Pathway
mcub00680  Methane metabolism
mcub01100  Metabolic pathways
mcub01120  Microbial metabolism in diverse environments
mcub01200  Carbon metabolism
Module
mcub_M00357  Methanogenesis, acetate => methane
mcub_M00567  Methanogenesis, CO2 => methane
mcub_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mcub00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MCBB_1981 (mtrB)
Enzymes [BR:mcub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MCBB_1981 (mtrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrB
Motif
Other DBs
NCBI-ProteinID: SCG86529
UniProt: A0A1D3L4T5
Position
I:complement(2059392..2059697)
Genome map
AA seq 101 aa AA seqDB search
MAEMLPLIKIAPESNLTLDPSTGVVGTALGRDVVVVSMDTINEQIAELEIAADDIEHALD
PTTVSPGAYPGREGVYMTAGKLTNMVYGFVLGLVLLVALLL
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatgttacctttaataaaaatagctcctgaatcaaacttaactcttgaccct
tccacaggtgtagttggaacagcattaggcagagacgtcgtagtagtatcaatggacact
ataaatgaacaaatagctgaattagagattgcagcagatgatattgaacacgctctcgat
ccaacaactgtgtccccaggtgcttaccctggaagggaaggagtttacatgacagcaggt
aaactaaccaacatggtttatggatttgtattagggcttgtactgctggtcgccctatta
ttatag

DBGET integrated database retrieval system